| PDBID: | 8vcs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vck | | Status: | HPUB -- hold until publication | | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8rfi | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of HER2/ErbB2 extracellular domain (ECD) in compact conformation with trastuzumab (TZB) antibody | | Authors: | Gragera, M., Buschiazzo, A., Vacca, S. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vah | | Status: | HPUB -- hold until publication | | Title: | E.coli PNPase in complex with single 8-oxoG RNA | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vak | | Status: | HPUB -- hold until publication | | Title: | E.coli PNPase in complex with double 8-oxoG RNA | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vb3 | | Status: | HPUB -- hold until publication | | Title: | Dienelactone hydrolase from Solimonas fluminis | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xch | | Status: | HPUB -- hold until publication | | Title: | Structural basis for template-product RNA duplex unwinding by SARS-CoV-2 helicase | | Authors: | Yan, L., Lou, Z. | | Deposition date: | 2023-12-09 | | Release date: | 2025-06-09 |
|
| PDBID: | 8xca | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cas12j19,crRNA and target DNA complex | | Authors: | Xi, Z. | | Deposition date: | 2023-12-08 |
|
| PDBID: | 8xcc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cas12j19 (E100K), crRNA and target DNA complex | | Authors: | Xi, Z. | | Deposition date: | 2023-12-08 |
|
| PDBID: | 8rby | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26 | | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8x6j | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8uy5 | | Status: | HPUB -- hold until publication | | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8ws8 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrv | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wru | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrt | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1/crRNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws5 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1-N2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrw | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1-N1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8qs2 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 | | Release date: | 2025-04-10 |
|
| PDBID: | 8qs5 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 | | Release date: | 2025-04-10 |
|
| PDBID: | 8qs6 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 | | Release date: | 2025-04-10 |
|
| PDBID: | 8qs7 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 70 (1084352) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 | | Release date: | 2025-04-10 |
|
| PDBID: | 8qs8 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 78 (1084378) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 | | Release date: | 2025-04-10 |
|
| PDBID: | 8qs9 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 83 (1084383) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 | | Release date: | 2025-04-10 |
|
