| PDBID: | 9gjx | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
| PDBID: | 9gk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkb | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9gk6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gke | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9j9w | | Status: | HOLD -- hold until a certain date | | Title: | T6SS effector TseN-TsiN from Acidovorax citrulli | | Authors: | Yan, S.Q., Dong, T. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9j9m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9n | | Status: | HOLD -- hold until a certain date | | Title: | artificial mononuclear Zn-bound metalloprotein 2 (M2:Zn) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9p | | Status: | HOLD -- hold until a certain date | | Title: | artificial mononuclear Zn-bound metalloprotein 3 (M3:Zn) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9o | | Status: | HOLD -- hold until a certain date | | Title: | artificial dinuclear Zn-bound metalloprotein 1 (D1:2Zn) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9q | | Status: | HOLD -- hold until a certain date | | Title: | artificial mononuclear Cu-bound metalloprotein 6 (M6:Cu) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9r | | Status: | HOLD -- hold until a certain date | | Title: | artificial mononuclear Zn-bound metalloprotein 6 (M6:Zn) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9x | | Status: | HOLD -- hold until a certain date | | Title: | Tetrahymena Ribozyme L-16 complex with small molecule inhibitor ZP-Tth70 | | Authors: | Pan, Z.L., Hu, H., Su, Z.M. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 | | Sequence: | >Entity 1
GAAAAGUUAUCAGGCAUGCACCUGGUAGCUAGUCUUUAAACCAAUAGAUUGCAUCGGUUUAAAAGGCAAGACCGUCAAAUUGCGGGAAAGGGGUCAACAGCCGUUCAGUACCAAGUCUCAGGGGAAACUUUGAGAUGGCCUUGCAAAGGGUAUGGUAAUAAGCUGACGGACAUGGUCCUAACCACGCAGCCAAGUCCUAAGUCAACAGAUCUUCUGUUGAUAUGGAUGCAGUUCACAGACUAAAUGUCGGUCGGGGAAGAUGUAUUCUUCUCAUAAGAUAUAGUCGGACCUCUCCUUAAUGGGAGCUAGCGGAUGAAGUGAUGCAACACUGGAGCCGCUGGGAACUAAUUUGUAUGCGAAAGUAUAUUGAUUAGUUUUGGAG
|
|
| PDBID: | 9j9s | | Status: | HOLD -- hold until a certain date | | Title: | artificial mononuclear Zn-bound metalloprotein 5 (M5:Zn) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9t | | Status: | HOLD -- hold until a certain date | | Title: | artificial mononuclear Zn-bound metalloprotein 4 (M4:Zn) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9u | | Status: | HOLD -- hold until a certain date | | Title: | artificial dinuclear Mn-bound metalloprotein 2 (D2:Mn) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9ja2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9j9v | | Status: | HOLD -- hold until a certain date | | Title: | artificial dinuclear Fe-bound metalloprotein 2 (D2:Fe) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9j9z | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of Outward state Anhydromuropeptide permease (AmpG) complex with GlcNAc-1,6-anhMurNAc | | Authors: | Chang, N., Kim, U., Cho, H. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9db6 | | Status: | HPUB -- hold until publication | | Title: | Sialidase682 co-crystallized with inhibitor DANA | | Authors: | Young, M.A., Rees, S.D., Chang, G. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9dbx | | Status: | HOLD -- hold until a certain date | | Title: | Structure of AG11-2F01 Fab in complex with A/Solomon Islands/3/2006 (H1N1) influenza virus hemagglutinin | | Authors: | Mou, Z., Lei, R., Dai, X., Wu, N. | | Deposition date: | 2024-08-23 | | Release date: | 2025-08-23 |
|
| PDBID: | 9dbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9db8 | | Status: | HPUB -- hold until publication | | Title: | Cu-Bound Structure of Computationally Designed Homotrimer Tet4 | | Authors: | Hoffnagle, A.M., Tezcan, F.A. | | Deposition date: | 2024-08-23 |
|
