| PDBID: | 9jaj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9jab | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9ja8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human phosphodiesterase 10A in complex with N-(2-amino-2-thioxoethyl)-2-(3-(3-(dimethylcarbamoyl)-6-fluoroimidazo[1,2-a]pyridin-2-yl)azetidin-1-yl)quinoline-4-carboxamide | | Authors: | Zhang, F.C., Huang, Y.Y., Luo, H.B., Guo, L. | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9ja3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9jaa | | Status: | HPUB -- hold until publication | | Title: | P[28] rotavirus VP8* | | Authors: | Zheng, Y., Yan, J. | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9ja4 | | Status: | HOLD -- hold until a certain date | | Title: | artificial dinuclear Zn-bound metalloprotein 2 (D2:Zn) | | Authors: | Jeong, W.J., Song, W.J. | | Deposition date: | 2024-08-24 | | Release date: | 2025-08-24 |
|
| PDBID: | 9ja7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9ja9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9jak | | Status: | HPUB -- hold until publication | | Title: | P[28] rotavirus VP8* protein with LNFP-I | | Authors: | Zheng, Y., Yan, J. | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9dby | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9dc0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9dbz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Molecular basis of pathogenicity of the recently emerged FCoV-23 coronavirus. FCoV-23 S long with Do in mixed conformations (global refinement). | | Authors: | Tortorici, M.A., Veesler, D., Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2024-08-24 |
|
| PDBID: | 9gk4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gka | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gk1 | | Status: | HPUB -- hold until publication | | Title: | SSX structure of human cytochrome P450 3A4 at room temperature | | Authors: | Glerup, J., Branden, G., Uwangue, O. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjz | | Status: | HOLD -- hold until a certain date | | Title: | Ntaya methyltransferase (MTase) bound to AT-9010 (2''-methyl-2''-fluoro GTP) | | Authors: | Boura, E., Krejcova, K. | | Deposition date: | 2024-08-23 | | Release date: | 2024-10-18 |
|
| PDBID: | 9gk3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gkf | | Status: | HPUB -- hold until publication | | Title: | Amyloid Fibril of Heterogeneous nuclear ribonucleoprotein A1A induced by RNA binding | | Authors: | Frey, L., Riek, R.P., Arosio, P., Morelli, C. | | Deposition date: | 2024-08-23 |
|
| PDBID: | 9gjy | | Status: | HPUB -- hold until publication | | Title: | Bacillus licheniformis nitroreductase | | Authors: | Crennell, S.J., Danson, M.J., Emptage, C. | | Deposition date: | 2024-08-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMTEQSKKQEILDAFQFRHATKEFDPDRKISDEDFQFILEAGRLSPSSVGLEPWQFVVVQNKELREKLRQVSWGAQGQLPTASHFVLLLGRTAKEMRRDSGYVADQLKHVKKMPEDIIENMLKEDGVLESFQDGDFHLYESDRAMFDWVSKQTYIALANMMTAAALIGIDSCPIEGFNYDKVHDILEKEGVLEDGRFDISVMAAFGYRVKEPRPKTRRALDQIVKWVE
|
|
