| PDBID: | 8rnp | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with R-limonene | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rno | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with isophorone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnk | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with myristic acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8viv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FBF-2 RBD in complex with gld-1 FBEa* RNA | | Authors: | Qiu, C., Hall, T.M.T. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8xpr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human eIF4A1-ATP analog-Rohinitib-polypurine RNA complex | | Authors: | Ito, T., Sakamoto, A. | | Deposition date: | 2024-01-04 |
|
| PDBID: | 8xko | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of compound HNC-1664 bound with RdRP-RNA complex of SARS-CoV-2 | | Authors: | Li, M., An, L., Hong, Y., Li, S., Zhang, K. | | Deposition date: | 2023-12-23 |
|
| PDBID: | 8rj7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.29 | | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | | Deposition date: | 2023-12-20 |
|
| PDBID: | 8ris | | Status: | HPUB -- hold until publication | | Title: | Computationally redesigend variant of Pyrrolysyl-tRNA Synthetase (Y306A) | | Authors: | Oberdorfer, G., Moser, M., Stoll, D. | | Deposition date: | 2023-12-19 |
|
| PDBID: | 8vco | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dimeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vcu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8vck | | Status: | HPUB -- hold until publication | | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with galactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8rfi | | Status: | HPUB -- hold until publication | | Title: | Ternary complex of HER2/ErbB2 extracellular domain (ECD) in compact conformation with trastuzumab (TZB) antibody | | Authors: | Gragera, M., Buschiazzo, A., Vacca, S. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8vah | | Status: | HPUB -- hold until publication | | Title: | E.coli PNPase in complex with single 8-oxoG RNA | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vak | | Status: | HPUB -- hold until publication | | Title: | E.coli PNPase in complex with double 8-oxoG RNA | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8vb3 | | Status: | HPUB -- hold until publication | | Title: | Dienelactone hydrolase from Solimonas fluminis | | Authors: | Schnettler Fernandez, J.D.F., Campbell, E.C., Hollfelder, F. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8xch | | Status: | HPUB -- hold until publication | | Title: | Structural basis for template-product RNA duplex unwinding by SARS-CoV-2 helicase | | Authors: | Yan, L., Lou, Z. | | Deposition date: | 2023-12-09 |
|
| PDBID: | 8xca | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cas12j19,crRNA and target DNA complex | | Authors: | Xi, Z. | | Deposition date: | 2023-12-08 |
|
| PDBID: | 8xcc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cas12j19 (E100K), crRNA and target DNA complex | | Authors: | Xi, Z. | | Deposition date: | 2023-12-08 |
|
| PDBID: | 8rby | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26 | | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rap | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Sen1-ADP.BeF3 bound RNA Polymerase II pre-termination complex | | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ran | | Status: | HPUB -- hold until publication | | Title: | Structure of Sen1-RNA complex | | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | | Deposition date: | 2023-12-01 |
|
