| PDBID: | 9r9q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.04 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-05-20 | | Release date: | 2026-05-20 |
|
| PDBID: | 9r9r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.21 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-05-20 | | Release date: | 2026-05-20 |
|
| PDBID: | 9r9s | | Status: | HOLD -- hold until a certain date | | Title: | [FeFe]-hydrogenase from Nitratidesulfovibrio vulgaris str. Hildenborough at pH 5.45 | | Authors: | Bikbaev, K., Span, I. | | Deposition date: | 2025-05-20 | | Release date: | 2026-05-20 |
|
| PDBID: | 9oov | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the heterotrimeric complex formed by two subunits of YrvO and a subunit of MnmA bound to tRNA-Glu | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-16 | | Release date: | 2025-11-16 |
|
| PDBID: | 9oow | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the heterotetrameric complex formed by two subunits of YrvO and two subunits of MnmA bound to tRNA-Glu | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-16 | | Release date: | 2025-11-16 |
|
| PDBID: | 9ony | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | N-terminal Six-His-Tagged FosB from Enterococcus faecium in complex with (1-Hydroxypropan-2-yl)phosphonic acid | | Authors: | Benton, H.M., Thompson, M.K. | | Deposition date: | 2025-05-15 |
|
| PDBID: | 9oo5 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the dimeric YrvO cysteine desulfurase | | Authors: | Zoumpoulakis, A., Gervason, S., Venien-Bryan, C., Golinelli-Pimpaneau, B., Fernandes, C.A.H. | | Deposition date: | 2025-05-15 | | Release date: | 2025-11-15 |
|
| PDBID: | 9uti | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tetrahymena Ribozyme L-16 complex with small molecule inhibitor ZPT-01 | | Authors: | Pan, Z.L., Ma, H.Y., Su, Z.M. | | Deposition date: | 2025-05-04 | | Release date: | 2026-05-04 |
|
| PDBID: | 9ulw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Cytochrome P450 GpeC | | Authors: | Zhou, J.H., Pang, C.P. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9um2 | | Status: | HPUB -- hold until publication | | Title: | Pterocarpan Reductase GuPTR1 from Glycyrrhiza uralensis | | Authors: | Li, H.Y., Zou, J.L., Zhang, M., Ye, M. | | Deposition date: | 2025-04-21 |
|
| PDBID: | 9qy7 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 54e bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-04-17 |
|
| PDBID: | 9uiz | | Status: | HPUB -- hold until publication | | Title: | PLASMODIUM VIVAX PHENYLALANYL-TRNA SYNTHETASE IN COMPLEX WITH PHE-AMS IN SPACE GROUP P21 | | Authors: | Mutharasappan, N., Manickam, Y., Bagale, S., Pradeepkumar, P.I., Sharma, A. | | Deposition date: | 2025-04-16 |
|
| PDBID: | 9qwv | | Status: | HPUB -- hold until publication | | Title: | Trypanosoma cruzi enoyl-CoA hydratase | | Authors: | Brannigan, J.A., Dodson, E.J. | | Deposition date: | 2025-04-15 | | Sequence: | >Entity 1
MLRKSLFLLNSMDPIVKYAQKGAVVTLTLNRPKQLNALNAELTNALAEKLLKCDADPSVSVLIITGEGRSFVAGADIKAMANQTFVEFYKHNMLRGLDTIAAVRKPIIAAVNGFALGGGCELAMSCDIVVASEKAIFGQPEIKIGTIPGAGGTQRLTRLIGKSKAMEWILTGEQYTAEEAERAGLVSRVVRHEELLPTVSAMAEKIALNSPLAVSLAKDCINKALETTLAQGMAYEQRTFQATFATDDQKEGMAAFVEKRKPNFKNA
|
|
| PDBID: | 9qx4 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme purified in HEPES, with Bis-Tris propane and phosphate in the active site | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-15 |
|
| PDBID: | 9o4m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Ubiquitin Carboxy Terminal Hydrolase L1 Q209C mutant covalently crosslinked to ubiquitin genetically encoded with N6-(6-bromohexanoyl)-L-lysine | | Authors: | Pannala, N., Patel, R., Das, C. | | Deposition date: | 2025-04-08 |
|
| PDBID: | 9ue2 | | Status: | AUCO -- author corrections pending review | | Title: | Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - Lys181Ser/Trp185Gly/His280Ala with (S)-2-fluoro-3-(4-(trifluoromethyl)phenyl)propanoic acid | | Authors: | Huang, H.S., Zhang, Z.M. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o1l | | Status: | HPUB -- hold until publication | | Title: | TMEM16F in liposomes in the absence of Ca2+ (expanded state) | | Authors: | Feng, Z., Accardi, A. | | Deposition date: | 2025-04-03 |
|
| PDBID: | 9qqx | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 54k bound to CK2a | | Authors: | Brear, P., Glossop, P., Pandey, S., Hyvonen, M., Spring, D., Butt, R., Cawkill, D. | | Deposition date: | 2025-04-02 |
|
| PDBID: | 9nzn | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Kirsten Rat Sarcoma G12C Complexed with GDP and Covalently Bound to an Adduct of (2S)-1-{4-[(7P)-7-(8-ethynyl-7-fluoro-3-hydroxynaphthalen-1-yl)-8-fluoro-2-{[(2R,4R,7aS)-2-fluorotetrahydro-1H-pyrrolizin-7a(5H)-yl]methoxy}pyrido[4,3-d]pyrimidin-4-yl]piperazin-1-yl}-2-fluoro-3-(1,3-thiazol-2-yl)propan-1-one | | Authors: | Sheriff, S., Pokross, M., Witmer, M. | | Deposition date: | 2025-04-01 |
|
| PDBID: | 9u9u | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - Lys181Met/Trp185Tyr/His280Ala with (S)-2-fluoro-3-(4-(trifluoromethyl)phenyl)propanoic acid | | Authors: | Huang, H.S., Zhang, Z.M. | | Deposition date: | 2025-03-29 |
|
| PDBID: | 9u9l | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - Trp181Tyr/His280Ala with 2-fluoro-3-phenylpropanoic acid | | Authors: | Huang, H.S., Zhang, Z.M. | | Deposition date: | 2025-03-28 |
|
| PDBID: | 9nwx | | Status: | HPUB -- hold until publication | | Title: | Discovery of a Small Molecule ITK and Pan-TRK Kinase Inhibitor (PF-07245303) for the Potential Topical Treatment of Atopic Dermatitis | | Authors: | Liu, S. | | Deposition date: | 2025-03-24 |
|
| PDBID: | 9u5y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome P450 mutant-T288G S289Q G290E T291I of CYP161H12 from Amycolatopsis pretoriensis | | Authors: | Dong, L.B., Zhang, X.W., Wang, Y.X., Pan, X.M., Liu, C.H. | | Deposition date: | 2025-03-22 |
|
| PDBID: | 9u5x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - Lys181Met/His280Ala with 2-fluoro-3-phenylpropanoic acid | | Authors: | Huang, H.S., Zhang, Z.M. | | Deposition date: | 2025-03-22 |
|
