| PDBID: | 9fyj | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand | | Authors: | Adrover Forteza, J., Puric, E., Nilsson, U.J., Anderluh, M., Logan, D.T. | | Deposition date: | 2024-07-03 | | Sequence: | >Entity 1
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSD
|
|
| PDBID: | 9fx9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of RV-A89 | | Authors: | Wald, J., Goessweiner-Mohr, N., Blaas, D., Marlovits, T.C. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fxz | | Status: | HPUB -- hold until publication | | Title: | Galectin-8 N-terminal carbohydrate recognition domain in complex with 4-(bromophenyl)phthalazinone D-galactal ligand | | Authors: | Van Klaveren, S., Hakansson, M., Diehl, C., Nilsson, N.J. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fy0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-aIF2beta leaderless mRNA | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fy5 | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND | | Authors: | Gazzi, T., Grether, U., Nazare, M., Hochstrasser, R., Wang, H., Heer, D., Topp, A., Benz, J. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9im4 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of AF9 YEATS domain F28R mutant in complex with histone H3K9la | | Authors: | Li, H.T., Ma, H.D. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9ci4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Fe/2-OG dependent dioxygenase MysH (Apo form) | | Authors: | Wanniarachchi, T.N., Bruner, S.D. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9chv | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | cryo-EM structure of calcineurin-fused beta2 adrenergic receptor in apo state | | Authors: | Jun, X., Geng, C., Yang, D., Brian, K.K. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9chx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | cryo-EM structure of calcineurin-fused beta2 adrenergic receptor in carazolol bound inactive state | | Authors: | Jun, X., Geng, C., Yang, D., Brian, K.K. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9chu | | Status: | AUCO -- author corrections pending review | | Title: | Cryo-EM structure of calcineurin fused beta2 adrenergic receptor in norepinephrine bound inactive state | | Authors: | Jun, X., Geng, C., Yang, D., Brian, K.K. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 9fxk | | Status: | HPUB -- hold until publication | | Title: | Transcription repressor NrdR from E. coli, AMPPNP/ATP-bound state | | Authors: | Bimai, O., Logan, D.T. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9fx1 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of RV-A89 | | Authors: | Wald, J., Goessweiner-Mohr, N., Blaas, D., Marlovits, T.C. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9fww | | Status: | HPUB -- hold until publication | | Title: | Human NKp30 in complex with a VHH variant | | Authors: | Musil, D., Freire, F. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9fxf | | Status: | HPUB -- hold until publication | | Title: | VHH variant adression natural cytotoxicity triggering receptor 3 | | Authors: | Musil, D., Freire, F. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9chn | | Status: | HPUB -- hold until publication | | Title: | P. vulgaris trimeric HigBA- operator 2 DNA | | Authors: | Pavelich, I.J., Schureck, M.A., Hoffer, E.D., Dunham, C.M. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilk | | Status: | HPUB -- hold until publication | | Title: | monomeric SarA, truncation of residue 20-124 | | Authors: | Xia, B., Fu, D.H. | | Deposition date: | 2024-06-30 |
|
| PDBID: | 9ill | | Status: | HPUB -- hold until publication | | Title: | monomeric SarA-E89Q in complex with DNA | | Authors: | Xia, B., Fu, D.H. | | Deposition date: | 2024-06-30 |
|
| PDBID: | 9fvr | | Status: | HPUB -- hold until publication | | Title: | Transcription repressor NrdR from E. coli, ATP/dATP-bound state, SeMet protein | | Authors: | Bimai, O., Sjoberg, B.M., Rozman Grinberg, I., Logan, D.T. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cgh | | Status: | HPUB -- hold until publication | | Title: | Photoactive yellow protein crystallized in situ on cyclic olefin copolymer microfluidic chip through counter diffusion | | Authors: | Liu, Z., Gu, K.K., Shelby, M.L., Roy, D., Muniyappan, S., Schmidt, M., Narayanasamy, S.R., Coleman, M.A., Frank, M., Kuhl, T.L. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cg0 | | Status: | HPUB -- hold until publication | | Title: | Human DJ-1, 30 sec mixing with methylglyoxal, pink beam time-resolved serial crystallography | | Authors: | Zielinski, K.A., Dolamore, C., Dalton, K., Meisburger, S.P., Smith, N., Termini, J., Henning, R., Srajer, V., Hekstra, D., Pollack, L., Wilson, M.A. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cgd | | Status: | HPUB -- hold until publication | | Title: | Human DJ-1, 10 sec mixing with methylglyoxal, pink beam time-resolved serial crystallography, CrystFEL processed | | Authors: | Zielinski, K., Dolamore, C., Dalton, K., Meisburger, S., Smith, N., Termini, J., Henning, R., Srajer, V., Hekstra, D., Pollack, L., Wilson, M.A. | | Deposition date: | 2024-06-28 |
|
| PDBID: | 9cf5 | | Status: | HPUB -- hold until publication | | Title: | STRUCTURE OF CD4 MIMETIC CJF-III-288 IN COMPLEX WITH BG505 SOSIP.664 HIV-1 ENV TRIMER AND 17B FAB | | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cfi | | Status: | HPUB -- hold until publication | | Title: | Human DJ-1, 3 sec mixing with methylglyoxal, pink beam time-resolved serial crystallography | | Authors: | Zielinski, K.A., Dolamore, C., Dalton, K., Meisburger, S.P., Smith, N., Termini, J., Henning, R., Srajer, V., Hekstra, D., Pollack, L., Wilson, M.A. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cfm | | Status: | HPUB -- hold until publication | | Title: | Human DJ-1, 5 sec mixing with methylglyoxal, pink beam time-resolved serial crystallography | | Authors: | Zielinski, K.A., Dolamore, C., Dalton, K., Meisburger, S.P., Smith, N., Termini, J., Henning, R., Srajer, V., Hekstra, D., Pollack, L., Wilson, M.A. | | Deposition date: | 2024-06-27 |
|
| PDBID: | 9cfo | | Status: | HPUB -- hold until publication | | Title: | Human DJ-1, 10 sec mixing with methylglyoxal, pink beam time-resolved serial crystallography | | Authors: | Zielinski, K., Dolamore, C., Dalton, K., Meisburger, S.P., Smith, N., Termini, J., Henning, R., Srajer, V., Hekstra, D., Pollack, L., Wilson, M.A. | | Deposition date: | 2024-06-27 |
|
