| PDBID: | 7itc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H06a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation | | Authors: | Lennartz, F., Weiss, M.S. | | Deposition date: | 2025-09-01 |
|
| PDBID: | 7ite | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H08a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation | | Authors: | Lennartz, F., Weiss, M.S. | | Deposition date: | 2025-09-01 |
|
| PDBID: | 7itg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H10a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation | | Authors: | Lennartz, F., Weiss, M.S. | | Deposition date: | 2025-09-01 |
|
| PDBID: | 7ith | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H11a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation | | Authors: | Lennartz, F., Weiss, M.S. | | Deposition date: | 2025-09-01 |
|
| PDBID: | 7iti | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H12a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation | | Authors: | Lennartz, F., Weiss, M.S. | | Deposition date: | 2025-09-01 |
|
| PDBID: | 9y1m | | Status: | HPUB -- hold until publication | | Title: | Cryo EM Structure of Full Length mGluR8 in Complex with Beta-Arrestin-1 Bound to Agonist L-AP4 and PAM VU6005649 | | Authors: | Marx, D.C., Levitz, J.T. | | Deposition date: | 2025-08-29 |
|
| PDBID: | 9y0a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Bet v 1.0101 in complex with human IgE Fab 2H22 | | Authors: | O''Malley, A., Borders, B.T., Smith, S.A., Chruszcz, M. | | Deposition date: | 2025-08-28 |
|
| PDBID: | 9y0e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Bet v 1.0101 in complex with human IgE Fab 2H22 | | Authors: | O''Malley, A., Borders, B.T., Smith, S.A., Chruszcz, M. | | Deposition date: | 2025-08-28 |
|
| PDBID: | 9si4 | | Status: | HPUB -- hold until publication | | Title: | Structure of human neutrophil elastase in complex with a 5,8-dihydro[1,2,4]triazolo[4,3-a]pyrimidin-3(2H)-one inhibitor | | Authors: | Rizzi, A., Armani, E. | | Deposition date: | 2025-08-28 |
|
| PDBID: | 9wia | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Helicoverpa armigera oral secretion R-like protein 1 | | Authors: | Zhang, Y.G., Ran, T.T., Wang, W.W., Zhang, F. | | Deposition date: | 2025-08-27 | | Release date: | 2026-08-27 |
|
| PDBID: | 9whz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | N-methyltransferase 1 complexed with SAH and MCM in Chimonanthus praecox | | Authors: | Zhang, A., Luo, Y., Hong, B. | | Deposition date: | 2025-08-27 |
|
| PDBID: | 9xzw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed Orb2 amyloid (FIMMF, polymorph 1) | | Authors: | Singh, R., Kaili, L., Si, K., Joachimiak, L. | | Deposition date: | 2025-08-27 | | Sequence: | >Entity 1
QLHQQQHQQQHFQHIQHMQQMQFHQHQQQLS
|
|
| PDBID: | 9sht | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human fibrillar procollagen type I C-propeptide heterotrimer complexed with PCPE-1 | | Authors: | Lipinski, O., Mariano, N., Dieryckx, C., Lagoutte, P., Juyoux, P., Kwong, H., Vadon-Le Goff, S., Carrique, L., Moali, C. | | Deposition date: | 2025-08-27 |
|
| PDBID: | 9shb | | Status: | PROC -- to be processed | | Title: | KP.3 SARS-CoV2 with fab JN-1.3 | | Authors: | Duyvesteyn, H.M.E., Ren, J., Stuart, D.I. | | Deposition date: | 2025-08-26 |
|
| PDBID: | 9shd | | Status: | HOLD -- hold until a certain date | | Title: | Structure of vaccinia virus A26 (residues 1-397) in complex with Fab 10M2146 | | Authors: | Battini, L., Guardado-Calvo, P. | | Deposition date: | 2025-08-26 | | Release date: | 2026-08-26 |
|
| PDBID: | 9sh3 | | Status: | HPUB -- hold until publication | | Title: | Mutant y91h of 1-aminocyclopropane-1-carboxylate oxidase from Amborella trichopoda in complex with ACC and Co | | Authors: | Sun, Y., Dhingra, S., Allen, M., Brewitz, L., Schofield, C.J., Zhang, Z. | | Deposition date: | 2025-08-25 |
|
| PDBID: | 9sh4 | | Status: | HPUB -- hold until publication | | Title: | Mutant n217q of 1-aminocyclopropane-1-carboxylate oxidase from Amborella trichopoda in complex with ACC and Co | | Authors: | Sun, Y., Dhingra, S., Allen, M., Brewitz, L., Schofield, C.J., Zhang, Z. | | Deposition date: | 2025-08-25 |
|
| PDBID: | 9q6m | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Vibrio cholerae PilU, a PilT-dependent Retraction ATPase - Crystal Form 1. | | Authors: | Minasov, G., Shukla, S., Shuvalova, L., Brunzelle, J.S., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-08-22 | | Release date: | 2026-08-22 |
|
| PDBID: | 9wfz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of PSII PsbA3-S264V from Thermosynechococcus vestitus BP-1 (local refinement) | | Authors: | Fan, S.B., Nakajima, Y., Shen, J.R. | | Deposition date: | 2025-08-22 |
|
| PDBID: | 9sgx | | Status: | HPUB -- hold until publication | | Title: | tbPEX38(65-134) in complex with tbPEX19(1-50) | | Authors: | Gaussmann, S. | | Deposition date: | 2025-08-22 |
|
| PDBID: | 9q5h | | Status: | HPUB -- hold until publication | | Title: | FNAIT Fab B2G1 CONFORMATION 1 | | Authors: | Zhang, H., Zhu, J.Q. | | Deposition date: | 2025-08-20 | | Sequence: | >Entity 1
QVQLVQSGAEVKRPGAAVKVSCKASGYRFTGHYMHWVRQAPGQGLEWMGWINPNSGGTSYAQKFQGRVTMTRDTSISTAYMEMTRLRYDDTAVYYCAAGGLGGYYYYAMNIWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
>Entity 2
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTWVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
|
|
| PDBID: | 9q5d | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of WT HIV-1 Protease (NL4-3) with Inhibitor J02-37 | | Authors: | Shaqra, A.M., Kaur, J., Schiffer, C.A. | | Deposition date: | 2025-08-20 |
|
| PDBID: | 9wev | | Status: | HPUB -- hold until publication | | Title: | Structure of human C5a anaphylatoxin chemotactic receptor 1 bound to human C5a anaphylatoxin (R74Y) | | Authors: | Tiwari, D., Yadav, M.K., Ganguly, M., Mishra, S., Dalal, A., Banerjee, R., Shukla, A.K. | | Deposition date: | 2025-08-20 |
|
| PDBID: | 9q3s | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of PGT121 Fab and Rhesus macaque Ab4 Fab in complex with HIV-1 Env trimer BG505 SOSIP.664 | | Authors: | Chandravanshi, M., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2025-08-19 |
|
| PDBID: | 9q3z | | Status: | HPUB -- hold until publication | | Title: | Structure of ClpC1 N-terminal Domain complexed with P-Arginine bound to site 1 | | Authors: | Abad-Zapatero, C., Ratia, K.M. | | Deposition date: | 2025-08-19 | | Sequence: | >Entity 1
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKLAAALEHHHHHH
|
|
