Loading
PDBj
MenuPDBj@FacebookPDBj@X(formerly Twitter)PDBj@BlueSkyPDBj@YouTubewwPDB FoundationwwPDBDonate
RCSB PDBPDBeBMRBAdv. SearchSearch help
PDBID:7itc
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H06a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation
Authors:Lennartz, F., Weiss, M.S.
Deposition date:2025-09-01
PDBID:7ite
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H08a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation
Authors:Lennartz, F., Weiss, M.S.
Deposition date:2025-09-01
PDBID:7itg
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H10a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation
Authors:Lennartz, F., Weiss, M.S.
Deposition date:2025-09-01
PDBID:7ith
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H11a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation
Authors:Lennartz, F., Weiss, M.S.
Deposition date:2025-09-01
PDBID:7iti
Status:AUTH -- processed, waiting for author review and approval
Title:PanDDA analysis group deposition -- SARS-CoV-2 Nsp1 crystal H12a (dataset 1) from the F2X-Entry library screening campaign, data used for ground state calculation
Authors:Lennartz, F., Weiss, M.S.
Deposition date:2025-09-01
PDBID:9y1m
Status:HPUB -- hold until publication
Title:Cryo EM Structure of Full Length mGluR8 in Complex with Beta-Arrestin-1 Bound to Agonist L-AP4 and PAM VU6005649
Authors:Marx, D.C., Levitz, J.T.
Deposition date:2025-08-29
PDBID:9y0a
Status:HPUB -- hold until publication
Title:Crystal structure of Bet v 1.0101 in complex with human IgE Fab 2H22
Authors:O''Malley, A., Borders, B.T., Smith, S.A., Chruszcz, M.
Deposition date:2025-08-28
PDBID:9y0e
Status:HPUB -- hold until publication
Title:Crystal structure of Bet v 1.0101 in complex with human IgE Fab 2H22
Authors:O''Malley, A., Borders, B.T., Smith, S.A., Chruszcz, M.
Deposition date:2025-08-28
PDBID:9si4
Status:HPUB -- hold until publication
Title:Structure of human neutrophil elastase in complex with a 5,8-dihydro[1,2,4]triazolo[4,3-a]pyrimidin-3(2H)-one inhibitor
Authors:Rizzi, A., Armani, E.
Deposition date:2025-08-28
PDBID:9wia
Status:HOLD -- hold until a certain date
Title:Crystal structure of Helicoverpa armigera oral secretion R-like protein 1
Authors:Zhang, Y.G., Ran, T.T., Wang, W.W., Zhang, F.
Deposition date:2025-08-27
Release date:2026-08-27
PDBID:9whz
Status:AUTH -- processed, waiting for author review and approval
Title:N-methyltransferase 1 complexed with SAH and MCM in Chimonanthus praecox
Authors:Zhang, A., Luo, Y., Hong, B.
Deposition date:2025-08-27
PDBID:9xzw
Status:HPUB -- hold until publication
Title:Cryo-EM structure of designed Orb2 amyloid (FIMMF, polymorph 1)
Authors:Singh, R., Kaili, L., Si, K., Joachimiak, L.
Deposition date:2025-08-27
Sequence:

>Entity 1


QLHQQQHQQQHFQHIQHMQQMQFHQHQQQLS
PDBID:9sht
Status:HPUB -- hold until publication
Title:Cryo-EM structure of human fibrillar procollagen type I C-propeptide heterotrimer complexed with PCPE-1
Authors:Lipinski, O., Mariano, N., Dieryckx, C., Lagoutte, P., Juyoux, P., Kwong, H., Vadon-Le Goff, S., Carrique, L., Moali, C.
Deposition date:2025-08-27
PDBID:9shb
Status:PROC -- to be processed
Title:KP.3 SARS-CoV2 with fab JN-1.3
Authors:Duyvesteyn, H.M.E., Ren, J., Stuart, D.I.
Deposition date:2025-08-26
PDBID:9shd
Status:HOLD -- hold until a certain date
Title:Structure of vaccinia virus A26 (residues 1-397) in complex with Fab 10M2146
Authors:Battini, L., Guardado-Calvo, P.
Deposition date:2025-08-26
Release date:2026-08-26
PDBID:9sh3
Status:HPUB -- hold until publication
Title:Mutant y91h of 1-aminocyclopropane-1-carboxylate oxidase from Amborella trichopoda in complex with ACC and Co
Authors:Sun, Y., Dhingra, S., Allen, M., Brewitz, L., Schofield, C.J., Zhang, Z.
Deposition date:2025-08-25
PDBID:9sh4
Status:HPUB -- hold until publication
Title:Mutant n217q of 1-aminocyclopropane-1-carboxylate oxidase from Amborella trichopoda in complex with ACC and Co
Authors:Sun, Y., Dhingra, S., Allen, M., Brewitz, L., Schofield, C.J., Zhang, Z.
Deposition date:2025-08-25
PDBID:9q6m
Status:HOLD -- hold until a certain date
Title:Crystal Structure of Vibrio cholerae PilU, a PilT-dependent Retraction ATPase - Crystal Form 1.
Authors:Minasov, G., Shukla, S., Shuvalova, L., Brunzelle, J.S., Satchell, K.J.F., Center for Structural Biology of Infectious Diseases (CSBID)
Deposition date:2025-08-22
Release date:2026-08-22
PDBID:9wfz
Status:AUTH -- processed, waiting for author review and approval
Title:Cryo-EM structure of PSII PsbA3-S264V from Thermosynechococcus vestitus BP-1 (local refinement)
Authors:Fan, S.B., Nakajima, Y., Shen, J.R.
Deposition date:2025-08-22
PDBID:9sgx
Status:HPUB -- hold until publication
Title:tbPEX38(65-134) in complex with tbPEX19(1-50)
Authors:Gaussmann, S.
Deposition date:2025-08-22
PDBID:9q5h
Status:HPUB -- hold until publication
Title:FNAIT Fab B2G1 CONFORMATION 1
Authors:Zhang, H., Zhu, J.Q.
Deposition date:2025-08-20
Sequence:

>Entity 1


QVQLVQSGAEVKRPGAAVKVSCKASGYRFTGHYMHWVRQAPGQGLEWMGWINPNSGGTSYAQKFQGRVTMTRDTSISTAYMEMTRLRYDDTAVYYCAAGGLGGYYYYAMNIWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV

>Entity 2


QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTWVFGGGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
PDBID:9q5d
Status:HPUB -- hold until publication
Title:Crystal Structure of WT HIV-1 Protease (NL4-3) with Inhibitor J02-37
Authors:Shaqra, A.M., Kaur, J., Schiffer, C.A.
Deposition date:2025-08-20
PDBID:9wev
Status:HPUB -- hold until publication
Title:Structure of human C5a anaphylatoxin chemotactic receptor 1 bound to human C5a anaphylatoxin (R74Y)
Authors:Tiwari, D., Yadav, M.K., Ganguly, M., Mishra, S., Dalal, A., Banerjee, R., Shukla, A.K.
Deposition date:2025-08-20
PDBID:9q3s
Status:REPL -- author sent new coordinates, entry to be reprocessed
Title:Cryo-EM structure of PGT121 Fab and Rhesus macaque Ab4 Fab in complex with HIV-1 Env trimer BG505 SOSIP.664
Authors:Chandravanshi, M., Tolbert, W.D., Pazgier, M.
Deposition date:2025-08-19
PDBID:9q3z
Status:HPUB -- hold until publication
Title:Structure of ClpC1 N-terminal Domain complexed with P-Arginine bound to site 1
Authors:Abad-Zapatero, C., Ratia, K.M.
Deposition date:2025-08-19
Sequence:

>Entity 1


MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKLAAALEHHHHHH

243911

건을2025-10-29부터공개중

PDB statisticsPDBj update infoContact PDBjnumon