| PDBID: | 8xtt | | Status: | HOLD -- hold until a certain date | | Title: | Nuclear receptor Nor1 ligand binding domain | | Authors: | Yoo, J.Y., Yoon, H.S. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epi | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8kf5 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril in AD3. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 8xto | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment L18-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
LGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtn | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 9f7t | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-K229R mutant: dimer | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8xtu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Rab5b GTPase domain from Leishmania donovani in complex with GDP | | Authors: | Zohib, M., Pal, R.K., Biswal, B.K., Arora, A. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 9f7l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8kfl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 9f7m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8kfb | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Intracellular B30.2 Domain of VpBTN3 in Complex with HMBPP-08 | | Authors: | Yang, Y.Y., Yi, S.M., Zhang, M.T., Chen, C.-C., Guo, R.-T. | | Deposition date: | 2023-08-15 |
|
| PDBID: | 9f7n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9epn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9ex7 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the E. coli BrxX methyltransferase in complex with Ocr | | Authors: | Adams, M.C., Ghilarov, D. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8xtq | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 2 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8kfi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 9eru | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Mouse CNPase catalytic domain with nanobody 7E | | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | | Deposition date: | 2024-03-25 | | Release date: | 2025-03-25 |
|
| PDBID: | 8xtr | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of the intron 3 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 9ewc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8xtp | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 4 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 9ewh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant Y109A | | Authors: | Dhamotharan, K., Schlundt, A., Guenther, S. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8q7d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8xts | | Status: | HPUB -- hold until publication | | Title: | CryoEM Structure of intron 1 | | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Dong, H.H., Huang, D.M., Su, Z.M. | | Deposition date: | 2024-01-11 |
|
