| PDBID: | 8xri | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 9feg | | Status: | HPUB -- hold until publication | | Title: | PARP15 in complex with a quinazolin-4-one inhibitor | | Authors: | Bosetti, C., Lehtio, L. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8xrf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 9f5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8xrh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8kdr | | Status: | HPUB -- hold until publication | | Title: | The local refined map of SARS-CoV-2 XBB Variant Spike protein complexed with antibody PW5-535 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9eum | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8xrk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8kds | | Status: | HPUB -- hold until publication | | Title: | Trimer state of SARS-CoV Spike protein complexed with antibody PW5-535 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9fda | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xro | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of 5-Aminoimidazole Ribonucleotide (AIR) Synthetase from Pyrococcus horikoshii with ATP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-01-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8kdt | | Status: | HPUB -- hold until publication | | Title: | The local refined map of SARS-CoV Spike protein complexed with antibody PW5-5 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9eov | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8xs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 | | Sequence: | >Entity 1
MATGQVKLQQSGAEFVKAGASVKLSCKTSGYTFNNYWIHWVKQSPGQGLEWIGEIDPSDGYSNYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCTSSTSVGGSWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSASAAHHHHHHGAAEQKLISEEDLNGAA
>Entity 2
MSDIELTQSPLSLPVSLGDQASISCTSSQSLLHSNGDTYLHWYLQKPGQSPKLLIYTLSNRFSGVPDRFSGSGSGTDFTLKISRVEAADLGIYFCSQTTHVPYTFGGGTKLEIKRADAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEGGGSDYKDDDDK
|
|
| PDBID: | 8kdv | | Status: | HPUB -- hold until publication | | Title: | Structure of Oval fibril at 3.5 Angstroms resolution | | Authors: | Li, D., Zhang, X., Zhu, P. | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9evz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8xrq | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 BA.1 spike RBD in complex bound with VacBB-639 | | Authors: | Liu, C.C., Ju, B., Zhang, Z. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8q67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 9ex5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8xrr | | Status: | HPUB -- hold until publication | | Title: | A complex structure of PDGFRA with an inhibitor RH140 | | Authors: | Zhu, S.J., Bi, S.Z. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8q69 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HsRNMT complexed with inhibitor DDD1060606 | | Authors: | Petit, A.P., Fyfe, P.K. | | Deposition date: | 2023-08-11 |
|
| PDBID: | 9erq | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8xrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 9es6 | | Status: | HPUB -- hold until publication | | Title: | ADP:BeF3-bound human mitochondrial Hsp60 double-ring complex | | Authors: | Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I., Shkolnisky, Y. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8q6d | | Status: | HPUB -- hold until publication | | Title: | Anaerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with HIF2alpha-CODD peptide (523-542), Fe(II) and 2-oxoglutarate (2OG) | | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | | Deposition date: | 2023-08-11 |
|
