| PDBID: | 8zfz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-08 |
|
| PDBID: | 8py4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 | | Release date: | 2025-01-25 |
|
| PDBID: | 9fpw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of carbonic anhydrase XIII with methyl 4-(2-phenylethylsulfanyl)-3-sulfamoyl-benzoate | | Authors: | Smirnov, A., Manakova, E.N., Grazulis, S., Paketuryte, V. | | Deposition date: | 2024-06-13 | | Sequence: | >Entity 1
MMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
|
|
| PDBID: | 9fpc | | Status: | HOLD -- hold until a certain date | | Title: | Architectural insights into the corrin and metal binding sites of CobN cobaltochelatase | | Authors: | Pickersgill, R.W. | | Deposition date: | 2024-06-13 | | Release date: | 2024-12-13 | | Sequence: | >Entity 1
DSRAVPTPAAWELGKKSAELLITRYTQDHGEWPTSFGLTAWGTSNMRTGGDDIAQALALIGVQPVWDMASRRVTGYEIVPPAKLARPRVDVTLRISGFFRDAFPEQIALFDKAVRAVGALDEDVEDNPIAARMKAEQARLVAGGADPQTAERRAGYRVFGSKPGAYGAGLQALIDENGWAGRNDLAEAWLVWGGYAYGAGEEGQAERGLLEERLRSVQAVVQNQDNREHDLLDSDDYYQFEGGMAATVESLTGAMPSVYHNDHSRPEKPVIRALEEELSRVVRGRAANPKWIAGVMRHGYKGAAEIAATVDYLFAFAATTGKVGNHHFEAVYQAYIADRAVHDFMAEKNPAALAETAAKLNEAIERGFWTPRSNSARFELENLS
|
|
| PDBID: | 8zfv | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2 in complex with ceftriaxone | | Authors: | Dhaka, P., Mahto, J.K., Tomar, S., Kumar, P. | | Deposition date: | 2024-05-08 | | Release date: | 2025-05-08 |
|
| PDBID: | 9fp7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8zfx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-08 |
|
| PDBID: | 9fp4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FGD2 (Rv0132c) from Mycobacterium tuberculosis crystallised with Anderson-Evans polyoxotungstate | | Authors: | Aderemi, A., Snee, M., Levy, C., Leys, D. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8zfu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-08 |
|
| PDBID: | 8zfy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-08 |
|
| PDBID: | 9fpd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8zg0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-08 |
|
| PDBID: | 9fpp | | Status: | HPUB -- hold until publication | | Title: | FGD2 (Rv0132c) from Mycobacterium tuberculosis with cofactor F420 crystallised with Anderson-Evans polyoxotungstate | | Authors: | Aderemi, A., Snee, M., Levy, C., Leys, D. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8zg1 | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248Y&D303E from Streptomyces showdoensis (Apo) | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-08 |
|
| PDBID: | 9fq3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zg8 | | Status: | HPUB -- hold until publication | | Title: | ZZ-domain of the Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 | | Authors: | Yang, W.S., Song, H.K. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8k6e | | Status: | HOLD -- hold until a certain date | | Title: | LnaB-Actin-PRUb ternary complex | | Authors: | Chen, T.T., Ouyang, S.Y. | | Deposition date: | 2023-07-25 | | Release date: | 2025-01-25 |
|
| PDBID: | 9fpx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DYRK1A in complex with Curcumin | | Authors: | Grygier, P., Pustelny, K., Czarna, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zg9 | | Status: | HPUB -- hold until publication | | Title: | Y-degron fused ZZ-domain of the Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 | | Authors: | Yang, W.S., Song, H.K. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9fqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zga | | Status: | HPUB -- hold until publication | | Title: | F-degron fused ZZ-domain of the Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 | | Authors: | Yang, W.S., Song, H.K. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9fq1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the disease-causing mutant P20S of human KCTD1 | | Authors: | Balasco, N., Ruggiero, A., Smaldone, G., Esposito, L., Berisio, R., Vitagliano, L. | | Deposition date: | 2024-06-14 | | Sequence: | >Entity 1
MSRPLITRSPASPLNNQGISTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD
|
|
| PDBID: | 8zgb | | Status: | HPUB -- hold until publication | | Title: | W-degron fused ZZ-domain of the Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 | | Authors: | Yang, W.S., Song, H.K. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 8k6f | | Status: | HOLD -- hold until a certain date | | Title: | LnaB-Actin-PRUb ternary complex | | Authors: | Chen, T.T., Ouyang, S.Y. | | Deposition date: | 2023-07-25 | | Release date: | 2025-01-25 |
|
| PDBID: | 9fq4 | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NADP holoenzyme, from Helicobacter pylori, with active site cysteine oxidised to sulfenic acid | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2024-06-14 |
|
