| PDBID: | 9btv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of rhesus antibody T646-a.01 in complex with HIV-1 Env Q23.17 MD39 SOSIP | | Authors: | Roark, R.S., Shapiro, L., Kwong, P.D. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9bk9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rid family protein PA0814 from Pseudomonas aeruginosa | | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | | Deposition date: | 2024-04-26 |
|
| PDBID: | 8vvt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8vvm | | Status: | HPUB -- hold until publication | | Title: | Structure of FabS1CE1-EPR1-1 in complex with the erythropoietin receptor | | Authors: | Singer, A.U., Bruce, H.A., Pavlenco, A., Ploder, L., Luu, G., Blazer, L., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9bu5 | | Status: | HPUB -- hold until publication | | Title: | CC ProXp-ala apo solution structure | | Authors: | Duran, A.D., Foster, M.P. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9bkr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Human TRIP12 WWE domain (isoform 2) in complex with ATP | | Authors: | Kimani, S., Dong, A., Li, Y., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8vvo | | Status: | HPUB -- hold until publication | | Title: | Structure of FabS1CE2-EPR1-1 in complex with the erythropoietin receptor | | Authors: | Singer, A.U., Bruce, H.A., Pavlenco, A., Ploder, L., Luu, G., Blazer, L., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2024-01-31 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAASGFNLRSYYMHWVRQAPGKGLEWVASISPYYSYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARHGYGAMDYWGQGTLVTVFNQIQGPSVFPLAPSSKSTSGGTAALGCLVKDYFPGPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
>Entity 2
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVSWYVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTQGTTSVTKSFNRGEC
>Entity 3
APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH
|
|
| PDBID: | 8iy3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of RnPKM2-FBP | | Authors: | Luo, L.J., Gou, D.M. | | Deposition date: | 2023-04-03 | | Release date: | 2024-10-31 |
|
| PDBID: | 9bks | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Human TRIP12 WWE domain (isoform 2) in complex with ADP | | Authors: | Kimani, S., Dong, A., Li, Y., Arrowsmith, C.H., Edwards, A.M., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8vvv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8vvw | | Status: | HPUB -- hold until publication | | Title: | Structure of the five-fold capsomer of the Drosophila retrotransposon Copia capsid | | Authors: | Liu, Y., Kelch, B.A. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8iz3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
| PDBID: | 9bl0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8vvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9bl8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8iyy | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein(SITE-pHorin)_pH7.0 | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
| PDBID: | 8iyz | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 S65T | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
| PDBID: | 9bkx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8vvl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8w1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9bkv | | Status: | HPUB -- hold until publication | | Title: | DosP R97A bent form | | Authors: | Kumar, P., Kober, D.L. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8iz0 | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 W66Y | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
| PDBID: | 9beg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8vvx | | Status: | HPUB -- hold until publication | | Title: | Human Aquaporin 2 from 2D electron diffraction data | | Authors: | Vahedi-Faridi, A., Lodowski, D.T., Engel, A., Transcontinental EM Initiative for Membrane Protein Structure (TEMIMPS) | | Deposition date: | 2024-01-31 | | Sequence: | >Entity 1
RSIAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHISGAHINPAVTVACLVGCHVSVLRAAFYVAAQLLGAVAGAALLHEITPADIRGDLAVNALSNSTTAGQAVTVELFLTLQLVLCIFASTDERRGENPGTPALSIGFSVALGHLLGIHYTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQS
|
|
| PDBID: | 8iz2 | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0 | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
