| PDBID: | 9f7a | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant P80R | | Authors: | Dhamotharan, K., Schlundt, A. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xhg | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 9f7d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xhj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-HBA complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8k56 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-21 | | Release date: | 2024-07-21 |
|
| PDBID: | 9f7i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7 | | Authors: | Brangulis, K., Surth, V., Marcinkiewicz, A.L., Akopjana, I., Kazaks, A., Bogans, J., Huber, A., Lin, Y.-P., Kraiczy, P. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8px3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-22 |
|
| PDBID: | 8px6 | | Status: | HPUB -- hold until publication | | Title: | Hepatitis B core protein with bound SLLGRM-dimer | | Authors: | Makbul, C., Khayenko, V., Maric, M.H., Bottcher, B. | | Deposition date: | 2023-07-22 |
|
| PDBID: | 9f73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xh8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8pxo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-23 | | Release date: | 2025-01-23 |
|
| PDBID: | 9f74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8pxe | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal dimerisation domain of Hh1141 | | Authors: | Wilk, P., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MASFEDTLKATIKSNTKQDIKILKIQNLQSSPDVKLVLIAVGNMQVPIFASKDGKLVMGVSNVFFAHKSEDMGAVGSLIKQTQSESKPDKAILDTLFKKIPQDEYIILRSPNKNAKKITYIVSDPNCPSCQKELNNIQERLKDSDVYMLLVGFVGEDSPIKSSMLRDRLLDVKDDKEKLKILREVYTPKSKVPTSYINIDIKDTMKINQKVIDAGIKSVPFVYERNKLEHHHHHHH
|
|
| PDBID: | 9f75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xhi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Toxin BmKaTX15-7A | | Authors: | Gu, M.Y. | | Deposition date: | 2023-12-17 |
|
| PDBID: | 8pxd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C-terminal domain of Hh1412 | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 9f76 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xhw | | Status: | HOLD -- hold until a certain date | | Title: | Haloquadratum walsbyi middle rhodopsin mutant - D84N | | Authors: | Ko, L.N., Lim, G.Z., Yang, C.S. | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8pxf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the full length Hh1412 Dsb homodimer. | | Authors: | Wilk, P., Orlikowska, M., Roszczenko-Jasinska, P., Jagusztyn-Krynicka, E.K. | | Deposition date: | 2023-07-23 | | Sequence: | >Entity 1
MDKAELQKTLQANKIQGNIVSSSDLGSGLSMVIVEVNNQQAPFLATDDGKMIFQAEVLIAQDKSTESRVQEFYKNLYEKEKLRISAKLKEVFKAQKANVFTFKAKKPSNKTIYIVSDFNCPYCQREFANLDKRLESANVELLVVGFLGEDSILKAANALKNKSGNQAKDIAMLQKLYTPKSKGQSMDIKAAMALTQAVADTGVRSVPYIIEPHHHHHH
|
|
| PDBID: | 9f77 | | Status: | HPUB -- hold until publication | | Title: | BAZ2A bromodomain in complex with acetylpyrrole derivative compound 27-TND19 | | Authors: | Dalle Vedove, A., Cazzanelli, G., Caflisch, A., Lolli, G. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xhn | | Status: | HOLD -- hold until a certain date | | Title: | Streptococcus pneumoniae-BceAB-ADP-Peptidisc Sample. | | Authors: | He, Y., Li, J., Luo, M. | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8pxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-23 |
|
| PDBID: | 9f78 | | Status: | HPUB -- hold until publication | | Title: | BAZ2A bromodomain in complex with acetylpyrrole derivative compound 28-TN23 | | Authors: | Dalle Vedove, A., Cazzanelli, G., Caflisch, A., Lolli, G. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8xhq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
