PDBID: | 9eyw | Status: | HPUB -- hold until publication | Title: | Human PRMT5 in complex with AZ compound 21 | Authors: | Debreczeni, J. | Deposition date: | 2024-04-09 |
|
PDBID: | 8x5u | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-19 |
|
PDBID: | 8p13 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 1 | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | Deposition date: | 2023-05-11 | Release date: | 2024-11-11 |
|
PDBID: | 9eyx | Status: | HPUB -- hold until publication | Title: | Human PRMT5 in complex with AZ compound 28 | Authors: | Debreczeni, J. | Deposition date: | 2024-04-09 |
|
PDBID: | 8x67 | Status: | HPUB -- hold until publication | Title: | solution structure of Pru p 7 | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
PDBID: | 8p15 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 2 | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | Deposition date: | 2023-05-11 | Release date: | 2024-11-11 |
|
PDBID: | 9eot | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-15 |
|
PDBID: | 8x65 | Status: | HPUB -- hold until publication | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8p3i | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-05-17 | Release date: | 2024-11-17 |
|
PDBID: | 9ez3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human CLK3 bound to RN129 | Authors: | Kraemer, A., Raig, N., Knapp, S. | Deposition date: | 2024-04-10 |
|
PDBID: | 8x66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8p3j | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-05-17 | Release date: | 2024-11-17 |
|
PDBID: | 9eyz | Status: | HOLD -- hold until a certain date | Title: | membrane complex from Haemophilus influenzae - conformation B | Authors: | Castro, D.K.S.V., Delepelaire, P., Biou, V. | Deposition date: | 2024-04-10 | Release date: | 2025-04-10 |
|
PDBID: | 8x62 | Status: | HPUB -- hold until publication | Title: | crystal structure of human Mcl-1 kinase domain in complex with RM1 | Authors: | Zhang, Z.M., Wang, L. | Deposition date: | 2023-11-20 |
|
PDBID: | 8p3k | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-05-17 | Release date: | 2024-11-17 |
|
PDBID: | 9ez0 | Status: | HPUB -- hold until publication | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a yeast expression system. | Authors: | Bahar, M.W., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I. | Deposition date: | 2024-04-10 |
|
PDBID: | 8x69 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH23010 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8p3f | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-05-17 | Release date: | 2024-11-17 |
|
PDBID: | 9ez4 | Status: | HPUB -- hold until publication | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp5/6 substrate peptide. | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | Deposition date: | 2024-04-10 |
|
PDBID: | 8x6a | Status: | AUTH -- processed, waiting for author review and approval | Title: | Complex structure of AtHPPD with Y18992 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8p38 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-05-17 | Release date: | 2024-11-17 |
|
PDBID: | 9ez6 | Status: | HPUB -- hold until publication | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp14/15 substrate peptide. | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | Deposition date: | 2024-04-10 |
|
PDBID: | 8p4v | Status: | AUTH -- processed, waiting for author review and approval | Title: | 80S yeast ribosome in complex with HaterumaimideQ | Authors: | Terrosu, S., Yusupov, M. | Deposition date: | 2023-05-23 |
|
PDBID: | 9ez7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | BsmI (Nicking top mutant) crystallized with Ca2+ and cognate dsDNA | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | Deposition date: | 2024-04-10 |
|
PDBID: | 9ezc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-11 |
|