PDBID: | 7gwj | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bdk | Status: | HPUB -- hold until publication | Title: | CP20.2 Fab in complex with HIV-1 Env BG505 SOSIP.664 and RM20A3 Fab | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | Deposition date: | 2024-04-12 |
|
PDBID: | 8vcs | Status: | HPUB -- hold until publication | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 7gwk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bdy | Status: | AUTH -- processed, waiting for author review and approval | Title: | AT-centric NF-kappaB RelA binding DNA | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Ghosh, G. | Deposition date: | 2024-04-13 |
|
PDBID: | 8vcq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with raffinose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bdz | Status: | AUTH -- processed, waiting for author review and approval | Title: | TA-centric NF-kappaB RelA binding DNA | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Wang, V., Ghosh, G. | Deposition date: | 2024-04-13 |
|
PDBID: | 8vcu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9be0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | GC-centric NF-kappaB RelA binding DNA | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Ghosh, G. | Deposition date: | 2024-04-13 |
|
PDBID: | 8vck | Status: | HPUB -- hold until publication | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 7gwn | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9be1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CG-centric NF-kappaB RelA binding DNA | Authors: | Biswas, T., Shahabi, S., Tsodikov, O.V., Wang, V., Ghosh, G. | Deposition date: | 2024-04-13 |
|
PDBID: | 8vd2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwp | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9be3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-13 |
|
PDBID: | 8vd0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9be4 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-13 |
|
PDBID: | 8vcg | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwr | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9b4v | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-21 | Release date: | 2025-03-21 |
|
PDBID: | 8vcf | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 7gws | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|