| PDBID: | 9c5g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-06 |
|
| PDBID: | 8vpf | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV spike in complex with CoV1-65 Fab (NTD-bound) | | Authors: | Bangaru, S., Ward, A.B. | | Deposition date: | 2024-01-16 |
|
| PDBID: | 9jdj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-31 |
|
| PDBID: | 9c5o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-06 |
|
| PDBID: | 8vp4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-16 |
|
| PDBID: | 9jdl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-31 |
|
| PDBID: | 9c5p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-06 |
|
| PDBID: | 8vow | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-16 |
|
| PDBID: | 9jdp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | crystal structure of USP28-AZ1 | | Authors: | Wang, Y., Wang, F. | | Deposition date: | 2024-09-01 |
|
| PDBID: | 9btn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 3ujw | | Status: | POLC -- waiting for a policy decision | | Title: | Solution structures of trimeric mannose-binding lectin | | Authors: | Miller, A., Phillips, A., Wallis, R., Perkins, S.J. | | Deposition date: | 2011-11-08 |
|
| PDBID: | 8tqy | | Status: | HPUB -- hold until publication | | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | | Deposition date: | 2023-08-08 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 9jdq | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of reductase EA | | Authors: | Tang, J., Liuqing, C. | | Deposition date: | 2024-09-01 |
|
| PDBID: | 3ujx | | Status: | POLC -- waiting for a policy decision | | Title: | Solution structures of tetrameric mannose-binding lectin | | Authors: | Miller, A., Phillips, A., Wallis, R., Perkins, S.J. | | Deposition date: | 2011-11-08 |
|
| PDBID: | 9c6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8tqw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-05 |
|
| PDBID: | 9jdt | | Status: | PROC -- to be processed | | Title: | Crystal structure of reductase 740 | | Authors: | Tang, J., Liuqing, C. | | Deposition date: | 2024-09-01 |
|
| PDBID: | 9c6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8vl1 | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli transcription-translation loosely coupled complex (TTC-LC) containing mRNA with a 36 nt long spacer, ops signal, RfaH, NusA, and fMet-tRNAs in E-site and P-site | | Authors: | Molodtsov, V., Wang, C., Ebright, R.H. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 9jdr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the auxin importer AUX1 in Arabidopsis thaliana in the apo state | | Authors: | Sun, L., Liu, X., Wei, H., Yang, Z. | | Deposition date: | 2024-09-01 |
|
| PDBID: | 9c5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8vle | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-11 |
|
| PDBID: | 9jds | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the auxin importer AUX1 in Arabidopsis thaliana in the IAA-bound state | | Authors: | Sun, L., Liu, X., Wei, H., Yang, Z. | | Deposition date: | 2024-09-01 |
|
| PDBID: | 9c60 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9jdv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-01 |
|
