| PDBID: | 9eug | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wxk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of UDP-Glucose 4-Epimerase (all4713) with UDP-glucose and NAD from Nostoc sp. PCC 7120 | | Authors: | Su, J.Y. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 9euh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wz9 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 in ternary complex with NAD and adenine | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 9eui | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vwl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Vibrio cholerae NFeoB in the apo form | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9euj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wmo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure analysis of tubulin and heterocyclic podophyllotoxins complex for anticancer agents | | Authors: | Zhao, W. | | Deposition date: | 2023-10-04 |
|
| PDBID: | 8j4o | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of the Acinetobacter baumannii LysR family regulator AceR effector-binding domain with Spermidine | | Authors: | Ma, J.M., Ge, H.H. | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 9euk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vxg | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The crystal structure of CYP125MRCA, an ancestrally reconstructed CYP125 enzyme | | Authors: | Doherty, D.Z., Bruning, J.B., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9eul | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vxi | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | The crystal structure of sitosterol-bound CYP125MRCA | | Authors: | Doherty, D.Z., Bell, S.G. | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9etx | | Status: | HPUB -- hold until publication | | Title: | KEAP1 BTB in complex with compound 23 | | Authors: | Richardson, W., Bullock, A.N., Rothweiler, E.M., Manning, C.E., Sweeney, M.N., Chalk, R., Huber, K.V.M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wv7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-23 |
|
| PDBID: | 9ety | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wys | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 9eu5 | | Status: | HOLD -- hold until a certain date | | Title: | SSX structure of Autotaxin at room temperature | | Authors: | Eymery, M.C., McCarthy, A.A., Foos, N., Basu, S. | | Deposition date: | 2024-03-27 | | Release date: | 2025-03-27 |
|
| PDBID: | 8x0u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-06 |
|
| PDBID: | 8jf8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 9eu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vs5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 9etu | | Status: | HPUB -- hold until publication | | Title: | Archaellum filament from the Halobacterium salinarum deltaAgl27 strain | | Authors: | Grossman-Haham, I., Shahar, A. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vzr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dehaloperoxidase A in complex with substrate 4-bromo-o-cresol | | Authors: | Aktar, M.S., de Serrano, V.S., Ghiladi, R.A., Franzen, S. | | Deposition date: | 2024-02-12 |
|
| PDBID: | 9eu3 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
