| PDBID: | 8zh9 | | Status: | HPUB -- hold until publication | | Title: | The structure of ELK1-DNA complex | | Authors: | Liu, G., Sun, L.T. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8rw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-02 |
|
| PDBID: | 7g2l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zh6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8rw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 7g2m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zgz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of inward state Anhydromuropeptide permease (AmpG) | | Authors: | Cho, H.S., Kim, U., Chang, N., Kim, H., Yoo, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8rw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 7g2n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zhd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8rwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 7g2o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zh2 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate and Communesin K | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8rw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 | | Sequence: | >Entity 1
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2
MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
| PDBID: | 7g2p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zgy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8rw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 7g2q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 7g31 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zh3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8rwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 7g32 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8rwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
