| PDBID: | 8z6r | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 3 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tjn | | Status: | HPUB -- hold until publication | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 1 in complex with antibody fragment 1B2: Crosslinked State 1 | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8z6s | | Status: | HPUB -- hold until publication | | Title: | Structure of XBB.1.16 S trimer with 2 down-RBDs complex with antibody CYFN1006-1. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tjo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 1 in complex with antibody fragment 1B2: Crosslinked Intra-State 1 | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8z6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tjp | | Status: | HPUB -- hold until publication | | Title: | KS-AT core of 6-deoxyerythronolide B synthase (DEBS) Module 3 crosslinked with its elongation ACP partner | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-07-23 |
|
| PDBID: | 8z6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8tkr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8z6e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8tks | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8z6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8tkk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-25 | | Release date: | 2024-11-20 |
|
| PDBID: | 8z6w | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 S trimer with 3 down-RBDs complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tk2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8z6z | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH-WT | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tk3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8z6y | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH mutant-V164K&V221A&H333K | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tk4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8z6i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tk5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8z6q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 XBB.1.16 Spike in complex with CYFN1006-1(S-CYFN1006-1 dimer trimer). | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8tk6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 |
|
| PDBID: | 8z6h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
