| PDBID: | 8s42 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8zi9 | | Status: | HPUB -- hold until publication | | Title: | Human left ventricle actin and myosin complex | | Authors: | Li, D.N., Zhao, Q.Y., Liu, C. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9g61 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Xylose Isomerase collected at 50C using serial fixed-target crystallography | | Authors: | Schulz, E.C., Prester, A., Stetten, D.V., Gore, G., Hatton, C.E., Bartels, K., Leimkohl, J.P., Schikora, H., Ginn, H.M., Tellkamp, F., Mehrabi, P. | | Deposition date: | 2024-07-17 |
|
| PDBID: | 8s4d | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8zia | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9g63 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-17 |
|
| PDBID: | 8s4l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8zic | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9g62 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-17 |
|
| PDBID: | 8s4f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 | | Sequence: | >Entity 1
MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8zie | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9fwz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-01 |
|
| PDBID: | 8zig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9g67 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rhizobium etli L-asparaginase ReAV K138H mutant with L-Asn | | Authors: | Pokrywka, K., Grzechowiak, M., Sliwiak, J., Worsztynowicz, P., Loch, J.I., Ruszkowski, M., Gilski, M., Jaskolski, M. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 8s4j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8zid | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Structure of free nucleosome asterisk -RFX5 | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9g66 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of WT Rhizobium etli L-asparaginase ReAV with L-Asn | | Authors: | Pokrywka, K., Grzechowiak, M., Sliwiak, J., Worsztynowicz, P., Loch, J.I., Ruszkowski, M., Gilski, M., Jaskolski, M. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 8s43 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8zjc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 9g68 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rhizobium etli L-asparaginase ReAV K138A mutant with L-Asn | | Authors: | Pokrywka, K., Grzechowiak, M., Sliwiak, J., Worsztynowicz, P., Loch, J.I., Ruszkowski, M., Gilski, M., Jaskolski, M. | | Deposition date: | 2024-07-18 |
|
| PDBID: | 8s4h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8zit | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 9g6g | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-18 |
|
| PDBID: | 8s4e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9g6h | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-18 |
|
