PDBID: | 9ikr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Tubulin-RB3-TTL-IKP105 | Authors: | Yang, J.H. | Deposition date: | 2024-06-28 | Release date: | 2025-06-28 |
|
PDBID: | 8raz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8yl2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 9iks | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Tubulin-DARPIN AC2 | Authors: | Yang, J.H. | Deposition date: | 2024-06-28 | Release date: | 2025-06-28 |
|
PDBID: | 8rb2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8ykr | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 8rb0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8yl5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 9ikp | Status: | HPUB -- hold until publication | Title: | Crystal structure of human malectin | Authors: | Si, Y.L. | Deposition date: | 2024-06-28 |
|
PDBID: | 8rb1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8yl0 | Status: | HOLD -- hold until a certain date | Title: | cryo-EM structure of Staphylococcus aureus(ATCC 29213) 70S ribosome in complex with MCX-190. | Authors: | Li, Y., Lu, G., Li, J., Pei, X., Lin, J. | Deposition date: | 2024-03-05 | Release date: | 2025-03-05 |
|
PDBID: | 9iko | Status: | AUTH -- processed, waiting for author review and approval | Title: | VF16QK in free solution | Authors: | Swaleeha, A., Bhattacharyya, S. | Deposition date: | 2024-06-28 |
|
PDBID: | 8raq | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-01 |
|
PDBID: | 8yl1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | cryo-EM structure of Staphylococcus aureus 70S ribosome (15B196) in complex with MCX-190. | Authors: | Li, Y., Lu, G., Li, J., Pei, X., Lin, J. | Deposition date: | 2024-03-05 |
|
PDBID: | 9ikq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-28 |
|
PDBID: | 8rar | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-01 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8yl3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 9ikt | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the tetrapyrrole binding domain in CoaR at 2 angstrom resolution | Authors: | Liu, X.C. | Deposition date: | 2024-06-28 |
|
PDBID: | 8rbj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8yks | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 9fwd | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-29 |
|
PDBID: | 8rbk | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8yku | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-05 |
|
PDBID: | 9iku | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of CTB10 | Authors: | Fu, K., Rao, Y.J. | Deposition date: | 2024-06-29 |
|
PDBID: | 9il8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of SME-1 Class A Carbapenemase in complex with Durlobactam | Authors: | Dhankhar, K., Hazra, S. | Deposition date: | 2024-06-29 |
|