| PDBID: | 8qu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 9fs6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Saccharolobus solfataricus 30S initiation complex bound to Ss-aIF2beta leaderless mRNA with h44 in up position | | Authors: | Bourgeois, G., Coureux, P.D., Mechulam, Y., Schmitt, E. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8qu6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8yc5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 cement-on-penton | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 9fsc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of ornithine decarboxylase from Leishmania infantum | | Authors: | Fiorillo, A., Ilari, A., Antonelli, L. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8yc8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 baseplate | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8qum | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9fs4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8quo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8yc1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Acid phosphate hydrolase from Shigella flexneri (apo) | | Authors: | Du, W.Y., Pan, X.M., Dong, L.B. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 9fs5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8yc3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 portal-adaptor | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8que | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 9fs9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8quf | | Status: | HPUB -- hold until publication | | Title: | carbonic anhydrase XII mimic in complex with 2-(3-((N-(4-sulfamoylbenzyl)pyridine-3-sulfonamido)methyl)phenoxy)acetic acid | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8yc4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 terminator | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 9fsa | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8yc6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 straight tail tube | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8qun | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 2-((5-cyano-4-hydroxy-6-(p-tolyl)pyrimidin-2-yl)thio)-N-(4-sulfamoylphenyl)acetamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9fsb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Coxsackievirus B3 3C protease in P121 spacegroup | | Authors: | Fairhead, M., Lithgo, R.M., MacLean, E.M., Bowesman-Jones, H., Aschenbrenner, J.C., Balcomb, B.H., Capkin, E., Chandran, A.V., Godoy, A.S., Marples, P.G., Fearon, D., von Delft, F., Koekemoer, L. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8qup | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8yc7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cyanophage Pan5 bent tail tube | | Authors: | Zhu, J., Li, Q., Zhou, C.Z. | | Deposition date: | 2024-02-17 |
|
| PDBID: | 9iij | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Engineered LmrR with V15 replaced by unnatural amino acid 4-amino-L-phenyl-cysteine | | Authors: | Zhou, Z., Huang, W. | | Deposition date: | 2024-06-20 |
|
| PDBID: | 8ycz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9iie | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryogenic Temperature Crystal Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap | | Authors: | Destan, E., DeMirci, H. | | Deposition date: | 2024-06-20 |
|
