| PDBID: | 8qrp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8y9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of nanobody MY6322 bound to human serum albumin (HSA) | | Authors: | Ding, Y., Zhong, P.Y. | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9frd | | Status: | HPUB -- hold until publication | | Title: | Wildtype EGFR bound with Compound 23 | | Authors: | Pagliarini, A.R., Milgram, B.C., Borrelli, D.R., OHearn, E., Huff, M.R., Ladd, B., Brooijmans, N., Henderson, J.A., Hilbert, B.J., Wang, W., Ito, T. | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8y9y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 |
|
| PDBID: | 8qrq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 9fr0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8qrr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8y9z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9fr4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8qrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8y9l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-07 | | Release date: | 2025-02-07 |
|
| PDBID: | 9fre | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8qru | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8y9n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-07 | | Release date: | 2025-02-07 |
|
| PDBID: | 9frb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8qrv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8ya2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9frh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8qrj | | Status: | HPUB -- hold until publication | | Title: | LCC-ICCG PETase mutant H218Y | | Authors: | Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L. | | Deposition date: | 2023-10-09 | | Sequence: | >Entity 1
MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
|
|
| PDBID: | 8y9m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-07 | | Release date: | 2025-02-07 |
|
| PDBID: | 9frf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-18 |
|
| PDBID: | 8qri | | Status: | HPUB -- hold until publication | | Title: | TRRAP and EP400 in the human Tip60 complex | | Authors: | Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., SChultz, P., Papai, G., Ben-Shem, A. | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8y9r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-07 |
|
| PDBID: | 9frg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-18 |
|
| PDBID: | 9fri | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-18 |
|
