| PDBID: | 8yvd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ijg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PAF-PAFR-GqiN-SCFV16 | | Authors: | Shen, C.S., Liu, J.F. | | Deposition date: | 2024-06-22 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8yvi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ijh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of PAF-PAFR-Gi-scfv16 | | Authors: | Shen, C.S., Liu, J.F. | | Deposition date: | 2024-06-22 |
|
| PDBID: | 8r32 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the GluK2 ligand-binding domain in complex with L-glutamate and BPAM344 at 1.60 A resolution | | Authors: | Bay, Y., Jeppesen, M.E., Frydenvang, K., Kastrup, J.S. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8yve | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9iji | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PAF-PAFR-arrestin-fab | | Authors: | Shen, C.S., Liu, J.F. | | Deposition date: | 2024-06-22 |
|
| PDBID: | 8r36 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Gluk1 ligand-binding domain in complex with kainate and BPAM538 at 1.90 A resolution | | Authors: | Bay, Y., Frantsen, S.M., Frydenvang, K., Kastrup, J.S. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8yvf | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 | | Sequence: | >Entity 1
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2
MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3
RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
| PDBID: | 9fsx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-23 |
|
| PDBID: | 8r2y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8yvm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9fsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-23 |
|
| PDBID: | 8r30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8yvn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ijj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-23 |
|
| PDBID: | 8r31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8yvj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2592-2710 bound to H5.2 nanobody | | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ftg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Closed conformation of the pentameric ligand-gated ion channel, DeCLIC at pH 5 with 10 mM Ca2+ | | Authors: | Rovsnik, U., Anden, O., Lycksell, M., Delarue, M., Howard, R.J., Lindahl, E. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8yv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9fti | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Open conformation of the pentameric ligand-gated ion channel, DeCLIC at pH 5 with 10mM EDTA | | Authors: | Rovsnik, U., Anden, O., Lycksell, M., Delarue, M., Howard, R.J., Lindahl, E. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8yv7 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Thialysine N-epsilon-acetyltransferase from Caenorhabditis elegans | | Authors: | Wang, N., Ma, X. | | Deposition date: | 2024-03-28 |
|
