| PDBID: | 9fou | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Acetophenone carboxylase subunit epsilon ApcE | | Authors: | Ermler, U., Heider, H., Demmer, U. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 9fok | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8y68 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8qjo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 9foy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ternary complex of a Mycobacterium tuberculosis DNA gyrase core fusion with DNA and the inhibitor AMK32b | | Authors: | Kokot, M., Hrast, M., Feng, L., Mitchenall, L.A., Lawson, D.M., Maxwell, A., Minovski, N., Anderluh, M. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8qjd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 9foj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LGTV TP21. Langat virus, strain TP21 | | Authors: | Bisikalo, K., Rosendal, E. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8y6e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8qjc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-13 |
|
| PDBID: | 9foq | | Status: | PROC -- to be processed | | Title: | T. thermophilus RNA pol aTT-Ap4A | | Authors: | Skerlova, J., Dubankova, A., Svachova, H., Kouba, T. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8qja | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y69 | | Status: | HPUB -- hold until publication | | Title: | LGR4-RSPO2-ZNRF3 (2:2:2) | | Authors: | Wang, L. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 9foo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Branching sucrase BRS-B with glucosyl-enzyme intermediate | | Authors: | Cioci, G., Benkoulouche, M., Claverie, M., Moulis, C., Remaud-Simeon, M. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8y6f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8qju | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 9fol | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Succinyl-CoA:(R)-benzylsuccinate CoA-transferase (BbsEF), D178-CoA adduct + succinate (weakly occupied) | | Authors: | Ermler, U., Heider, J., Demmer, U. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8qjp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 9fov | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8y6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8qjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 9fot | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8qji | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GSK3b in complex with N-(4-(5-(1,2,4-oxadiazol-3-yl)thiophen-2-yl)pyridin-2-yl)cyclopropanecarboxamide inhibitor (TW362) | | Authors: | Slugocka, E.A., Grygier, P., Wichur, T., Czarna, A., Wieckowska, A. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
MKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVS(PTR)ICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARENLYFQ
|
|
| PDBID: | 8y6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
