| PDBID: | 9cic | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8y08 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 9cia | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8qi9 | | Status: | HPUB -- hold until publication | | Title: | CrPhotLOV1 dark state structure determined by serial synchrotron crystallography at room temperature | | Authors: | Gotthard, G., Mous, S., Weinert, T., Maia, R.N.A., James, D., Dworkowski, F., Gashi, D., Antonia, F., Wang, M., Panepucci, E., Ozerov, D., Schertler, G.F.X., Heberle, J., Standfuss, J., Nogly, P. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8y09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 9cib | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8qib | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8y0a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 9cih | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8qhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8y0b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 9cii | | Status: | PROC -- to be processed | | Title: | Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D/L36R at cryogenic temperature | | Authors: | Zhang, Y., Schlessman, J.L., Robinson, A.C., Garcia-Moreno E., B. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8qhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8y0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 4qbp | | Status: | POLC -- waiting for a policy decision | | Title: | Small-angle neutron scattering (SANS) solution structure of anti-streptavidin immunoglobulin G class 2 (ASA-IgG2) monoclonal antibody | | Authors: | Clark, N.J., Zhang, H., McAuley, M., Curtis, J.E. | | Deposition date: | 2014-05-08 |
|
| PDBID: | 9cis | | Status: | PROC -- to be processed | | Title: | Crystal structure of the pyrophosphate-dependent phosphofructokinase from Candidatus Prometheoarchaeum syntrophicum with fructose 6-phosphate | | Authors: | Compton, J.A., Yosaatmadja, Y., Bashiri, G., Vickers, C.J., Patrick, W.M. | | Deposition date: | 2024-07-04 | | Release date: | 2025-07-04 |
|
| PDBID: | 8qhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8y0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 9cir | | Status: | PROC -- to be processed | | Title: | Crystal structure of pyrophosphate-dependent phosphofructokinase from Candidatus Prometheoarchaeum syntrophicum | | Authors: | Compton, J.A., Yosaatmadja, Y., Bashiri, G., Vickers, C.J., Patrick, W.M. | | Deposition date: | 2024-07-04 | | Release date: | 2025-07-04 |
|
| PDBID: | 8qhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8y0j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 9cit | | Status: | PROC -- to be processed | | Title: | Crystal structure of pyrophosphate-dependent phosphofructokinase from Candidatus Prometheoarchaeum syntrophicum with phosphoenolpyruvate, phosphate and Mg2+ | | Authors: | Compton, J.A., Yosaatmadja, Y., Bashiri, G., Vickers, C.J., Patrick, W.M. | | Deposition date: | 2024-07-04 | | Release date: | 2025-07-04 |
|
| PDBID: | 8qi0 | | Status: | HPUB -- hold until publication | | Title: | 340A Vipp1 H1-6 helical tubes | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8y0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
