| PDBID: | 9g78 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 8zub | | Status: | HPUB -- hold until publication | | Title: | The Crystal structure of mol075 bound to the main protease (3CLpro/Mpro) of SARS-CoV-2 | | Authors: | Yan, M., Zhang, H. | | Deposition date: | 2024-06-08 |
|
| PDBID: | 9g70 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 9g71 | | Status: | HPUB -- hold until publication | | Title: | TTYH2 with lipids in GDN | | Authors: | Sukalskaia, A., Weber, F., Plochberger, B., Dutzler, R. | | Deposition date: | 2024-07-19 |
|
| PDBID: | 8r44 | | Status: | HPUB -- hold until publication | | Title: | PAS-GAF bidomain of Glycine max phytochrome A | | Authors: | Guan, K., Nagano, S., Hughes, J. | | Deposition date: | 2023-11-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8zu9 | | Status: | HPUB -- hold until publication | | Title: | The complex structure of MPXV M1R and neutralizing antibody A129 | | Authors: | Ge, J.W. | | Deposition date: | 2024-06-08 |
|
| PDBID: | 9g77 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-19 |
|
| PDBID: | 8r45 | | Status: | HPUB -- hold until publication | | Title: | Phytochromobilin-adducted PAS-GAF bidomain of Glycine max phytochrome A | | Authors: | Guan, K., Chen, P., Nagano, S., Hughes, J. | | Deposition date: | 2023-11-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8zu8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human PIEZO1-A1988V-MDFIC | | Authors: | Zhang, M.F. | | Deposition date: | 2024-06-08 | | Release date: | 2025-06-08 |
|
| PDBID: | 9g7e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ASGPR with bound guanosine | | Authors: | Schreuder, H.A., Hofmeister, A. | | Deposition date: | 2024-07-20 | | Sequence: | >Entity 1
MGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLGSHHHHHH
|
|
| PDBID: | 8r4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8zua | | Status: | HPUB -- hold until publication | | Title: | The complex structure of MPXV M1R and neutralizing antibody A138 | | Authors: | Ge, J.W. | | Deposition date: | 2024-06-08 |
|
| PDBID: | 9g7c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 8r4f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the native copper efflux oxidase (CueO) from Hafnia alvei | | Authors: | Leone, P., Contaldo, U. | | Deposition date: | 2023-11-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8zuc | | Status: | HPUB -- hold until publication | | Title: | The Crystal structure of mol080 bound to the main protease (3CLpro/Mpro) of SARS-CoV-2 | | Authors: | Yan, M., Zhang, H. | | Deposition date: | 2024-06-08 |
|
| PDBID: | 9g7a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 8r4h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the copper efflux oxidase (CueO) from Hafnia alvei deleted of the Met-rich domain | | Authors: | Leone, P., Contaldo, U. | | Deposition date: | 2023-11-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8zui | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-09 |
|
| PDBID: | 9g79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 8r4n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of neutralizing Fab Eq4.Dp46-3A from equine antivenom bound to short chain three finger alpha-neurotoxin from Dendroaspis polylepis. | | Authors: | Wibmer, C.K. | | Deposition date: | 2023-11-14 | | Release date: | 2025-05-14 |
|
| PDBID: | 8zuj | | Status: | HPUB -- hold until publication | | Title: | Pentagonal cluster of BAFF-BAFFR ectodomain complex | | Authors: | Lim, C.S., Lee, J.O. | | Deposition date: | 2024-06-09 |
|
| PDBID: | 9g7f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 8r4p | | Status: | HPUB -- hold until publication | | Title: | Structure of BabA from Helicobacter pylori strain 17875 | | Authors: | Persson, K., Boren, T., Bugaytsova, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8zuk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-09 |
|
| PDBID: | 9g7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
