| PDBID: | 8q51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8ymi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-09 |
|
| PDBID: | 8q4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8yme | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-09 |
|
| PDBID: | 9flg | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the Delta60 domain of the hepatitis delta virus small antigen SHDAg | | Authors: | Yang, Y., Delcourte, L., Fogeron, M.L., Bockmann, A., Lecoq, L. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 9flr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human Haspin (GSG2) kinase bound to MU1963 | | Authors: | Kraemer, A., Paruch, K., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8q4s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with AP4 and magnesium. | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8ymd | | Status: | HPUB -- hold until publication | | Title: | Galectin-3 with lychnose | | Authors: | Su, J.Y. | | Deposition date: | 2024-03-09 |
|
| PDBID: | 9flq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human Haspin (GSG2) kinase bound to MU1959 | | Authors: | Kraemer, A., Paruch, K., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8q53 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) in apo form | | Authors: | Kumar, A., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8ymm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OSCA1.1-F516A open | | Authors: | Zhang, M.F. | | Deposition date: | 2024-03-09 | | Release date: | 2025-03-09 |
|
| PDBID: | 9flo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human Haspin (GSG2) kinase bound to MU2181 | | Authors: | Kraemer, A., Paruch, K., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8kdi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8ymn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OSCA1.1-F516A pre-open 2 | | Authors: | Zhang, M.F. | | Deposition date: | 2024-03-09 | | Release date: | 2025-03-09 |
|
| PDBID: | 9fm3 | | Status: | HPUB -- hold until publication | | Title: | KlenTaq DNA polymerase in a ternary complex with primer/template and a selenophene-modified dUTP (SedUTP) | | Authors: | Betz, K., Srivatsan, S.G. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8kcj | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N7 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8ymo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OSCA1.1-F516A pre-open 1 | | Authors: | Zhang, M.F. | | Deposition date: | 2024-03-09 | | Release date: | 2025-03-09 |
|
| PDBID: | 9flh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8kck | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -N9 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-07 | | Sequence: | >Entity 1
GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
| PDBID: | 8ymp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OSCA1.1-F516A nanodisc in LPC | | Authors: | Zhang, M.F. | | Deposition date: | 2024-03-09 | | Release date: | 2025-03-09 |
|
| PDBID: | 9flj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C-terminal domain of VldE from Streptococcus pneumoniae containing three zinc atoms at the binding site | | Authors: | Acebron, I., Miguel-Ruano, V., Hermoso, J.A. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8q86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-18 | | Release date: | 2025-02-18 |
|
| PDBID: | 8ymq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OSCA1.1-F516A nanodisc | | Authors: | Zhang, M.F. | | Deposition date: | 2024-03-09 | | Release date: | 2025-03-09 |
|
| PDBID: | 9flk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C-terminal domain of VldE from Streptococcus pneumoniae containing two zinc atoms at the binding site | | Authors: | Acebron, I., Miguel-Ruano, V., Hermoso, J.A. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8kgb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-18 |
|
