| PDBID: | 9fpv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of carbonic anhydrase XIII with methyl 4-benzylsulfanyl-3-sulfamoyl-benzoate | | Authors: | Smirnov, A., Manakova, E.N., Grazulis, S., Paketuryte, V. | | Deposition date: | 2024-06-13 | | Sequence: | >Entity 1
MMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
|
|
| PDBID: | 9fpw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of carbonic anhydrase XIII with methyl 4-(2-phenylethylsulfanyl)-3-sulfamoyl-benzoate | | Authors: | Smirnov, A., Manakova, E.N., Grazulis, S., Paketuryte, V. | | Deposition date: | 2024-06-13 | | Sequence: | >Entity 1
MMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
|
|
| PDBID: | 8z4p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8qmu | | Status: | HPUB -- hold until publication | | Title: | The complex of Glycogen Phosphorylase with (-)-Epigallocatechin-3-gallate (EGCG). | | Authors: | Alexopoulos, S., Papakostopoulou, S., Koulas, M.S., Leonidas, D.D., Skamnaki, V. | | Deposition date: | 2023-09-25 | | Release date: | 2024-09-25 |
|
| PDBID: | 8qmv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9fpc | | Status: | HOLD -- hold until a certain date | | Title: | Architectural insights into the corrin and metal binding sites of CobN cobaltochelatase | | Authors: | Pickersgill, R.W. | | Deposition date: | 2024-06-13 | | Release date: | 2024-12-13 | | Sequence: | >Entity 1
DSRAVPTPAAWELGKKSAELLITRYTQDHGEWPTSFGLTAWGTSNMRTGGDDIAQALALIGVQPVWDMASRRVTGYEIVPPAKLARPRVDVTLRISGFFRDAFPEQIALFDKAVRAVGALDEDVEDNPIAARMKAEQARLVAGGADPQTAERRAGYRVFGSKPGAYGAGLQALIDENGWAGRNDLAEAWLVWGGYAYGAGEEGQAERGLLEERLRSVQAVVQNQDNREHDLLDSDDYYQFEGGMAATVESLTGAMPSVYHNDHSRPEKPVIRALEEELSRVVRGRAANPKWIAGVMRHGYKGAAEIAATVDYLFAFAATTGKVGNHHFEAVYQAYIADRAVHDFMAEKNPAALAETAAKLNEAIERGFWTPRSNSARFELENLS
|
|
| PDBID: | 8z4u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8qmw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9fp5 | | Status: | HPUB -- hold until publication | | Title: | Coxsackievirus A9 bound with CL213. | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8z4z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8qmq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9fp4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FGD2 (Rv0132c) from Mycobacterium tuberculosis crystallised with Anderson-Evans polyoxotungstate | | Authors: | Aderemi, A., Snee, M., Levy, C., Leys, D. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8z4w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8qmr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8z4x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 D614G S with two ACE2 receptors binding (RB2) in prefusion conformation | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 8qn4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 9fpd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8z4y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the USP11 deubiquitinase domain | | Authors: | Zhengyang, Z., Yu, G., Yikang, A., Hongying, L. | | Deposition date: | 2024-04-17 |
|
| PDBID: | 9fpp | | Status: | HPUB -- hold until publication | | Title: | FGD2 (Rv0132c) from Mycobacterium tuberculosis with cofactor F420 crystallised with Anderson-Evans polyoxotungstate | | Authors: | Aderemi, A., Snee, M., Levy, C., Leys, D. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8qms | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8z51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9fpx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DYRK1A in complex with Curcumin | | Authors: | Grygier, P., Pustelny, K., Czarna, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8qmt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
| PDBID: | 8z52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9fqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
