| PDBID: | 8yio | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in azoxystrobin-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8jri | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-16 | | Release date: | 2024-12-16 |
|
| PDBID: | 9fhr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure hASF1A 156-cr11 | | Authors: | Ochsenbein, F.O., Vitard, A.V. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8yia | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9fi8 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | SSU (head) structure derived from the SSU sample of the mitoribosome from T. gondii. | | Authors: | Rocha, R.E.O., Barua, S., Boissier, F., Nguyen, T.T., Hashem, Y. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8yil | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8ofz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-17 | | Release date: | 2024-09-17 |
|
| PDBID: | 9fhs | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-28 | | Release date: | 2025-05-28 |
|
| PDBID: | 8yin | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF23694-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9fi7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-28 | | Release date: | 2025-05-28 |
|
| PDBID: | 8yiv | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8pq6 | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pyogenes GapN in complex with NADPH and glyceraldehyde-3-phosphate | | Authors: | Wirsing, R., Schindelin, H. | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 9fi9 | | Status: | HPUB -- hold until publication | | Title: | Human PIF + Z48847594 (OCCUPANCY 0.7) | | Authors: | Bax, B.D., Sanders, C.M., Antson, A.A., Brandao-Neto, J. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8yj2 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8pq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 9fig | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8yj3 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8k0u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 9fid | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8xvd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-14 |
|
| PDBID: | 8k0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 9fie | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8yj9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8phm | | Status: | HPUB -- hold until publication | | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | | Deposition date: | 2023-06-20 | | Release date: | 2024-12-20 | | Sequence: | >Entity 1
NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8yjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
