| PDBID: | 9bjj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8vx4 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound to a 35-bp DNA with an 8-oxoG in the middle | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8j3g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-07-17 |
|
| PDBID: | 9bje | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8vx5 | | Status: | HPUB -- hold until publication | | Title: | Nucleosome core particle containing an 8-oxoG damage site | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8j3h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-07-17 |
|
| PDBID: | 9bjg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8vx6 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound at the nucleosomal DNA entry site | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8j3i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-07-17 |
|
| PDBID: | 9bjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8j33 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS main protease in complex with PF00835231 | | Authors: | Zhou, X.L., Lin, C., Zou, X.F., Zhang, J., Li, J. | | Deposition date: | 2023-04-16 | | Release date: | 2024-07-17 |
|
| PDBID: | 8vx7 | | Status: | HPUB -- hold until publication | | Title: | Computationally designed tunable C2 symmetric tandem repeat homodimer, bound to cyclic peptide | | Authors: | Kennedy, M.A., Stoddard, B.L., Said, M. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 9bsr | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-136B | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8w2a | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-20 | | Release date: | 2025-02-20 |
|
| PDBID: | 9bst | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor CID8009_5647 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8vxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9bsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8vxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9bsz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 9bt1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 9bt5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8vxo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of modified JEV virus E protein dimer | | Authors: | Galkin, A., Pozharski, E., Li, Y. | | Deposition date: | 2024-02-05 | | Release date: | 2025-02-05 |
|
| PDBID: | 9bt2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8vxk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the Apo Bacillus subtilis GabR C-terminal Effector-binding and Oligomerization Domain | | Authors: | Kaley, N.E., Liu, D. | | Deposition date: | 2024-02-05 |
|
