| PDBID: | 8q7k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8xtv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AaHPPD-Y14150 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 9f1z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-20 |
|
| PDBID: | 8q7g | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol pH 7.0 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9fdx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with the peptide-based inhibitor KT9 | | Authors: | Friedrich, F., Schutkowski, M., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 8xtx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8q7o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the FZD3 cysteine-rich domain in complex with a nanobody (14478) | | Authors: | Hillier, J.S., Zhao, Y., Malinauskas, T., Jones, E.Y. | | Deposition date: | 2023-08-16 |
|
| PDBID: | 9ep2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-03-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8xtw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 9fbk | | Status: | HPUB -- hold until publication | | Title: | Diheme cytochrome c Kustd1711 from Kuenenia stuttgartiensis, without glycerol cryoprotectant | | Authors: | Hauser, D., Barends, T.R.M. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8xu6 | | Status: | HOLD -- hold until a certain date | | Title: | Study on zinc finger structure and function of tumor suppressor ZMYND11 | | Authors: | Bai, X., Chen, Z., Chen, Z. | | Deposition date: | 2024-01-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8kfo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 9fbn | | Status: | HPUB -- hold until publication | | Title: | Dye-decolourising peroxidase DtpB XRPP experiment (1000 kGy) | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Owen, R.L., Maly, M. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8xuf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8kfq | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of EGFR(T797M/L858R) with small molecule inhibitor B6 | | Authors: | Wu, C., Ouyang, L. | | Deposition date: | 2023-08-16 |
|
| PDBID: | 9exl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8xtz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8q7u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-17 |
|
| PDBID: | 9eyo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8xu7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 9eyp | | Status: | HPUB -- hold until publication | | Title: | The structure of octameric pore of RN1 variant of actinoporin Fav | | Authors: | Solinc, G., Srnko, M., Anderluh, G., Crnkovic, A., Podobnik, M. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8q80 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-17 |
|
| PDBID: | 8xu9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH20531 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-12 |
|
| PDBID: | 9f3r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-25 |
|
| PDBID: | 8q81 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-17 |
|
