PDBID: | 8xtt | Status: | HOLD -- hold until a certain date | Title: | Nuclear receptor Nor1 ligand binding domain | Authors: | Yoo, J.Y., Yoon, H.S. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
PDBID: | 9eph | Status: | HPUB -- hold until publication | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | Deposition date: | 2024-03-18 |
|
PDBID: | 9epi | Status: | HPUB -- hold until publication | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | Deposition date: | 2024-03-18 |
|
PDBID: | 8kf5 | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril in AD3. | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | Deposition date: | 2023-08-15 |
|
PDBID: | 8xto | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment L18-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 LGGGSVRFGPGVAFRAPSIHG
|
|
PDBID: | 8xtn | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
PDBID: | 9f7t | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-K229R mutant: dimer | Authors: | Camara-Artigas, A. | Deposition date: | 2024-05-04 |
|
PDBID: | 9f7o | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-04 |
|
PDBID: | 8xtu | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Rab5b GTPase domain from Leishmania donovani in complex with GDP | Authors: | Zohib, M., Pal, R.K., Biswal, B.K., Arora, A. | Deposition date: | 2024-01-11 |
|
PDBID: | 9f7l | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-04 |
|
PDBID: | 8kfl | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-15 |
|
PDBID: | 9f7m | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-04 |
|
PDBID: | 8kfb | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Intracellular B30.2 Domain of VpBTN3 in Complex with HMBPP-08 | Authors: | Yang, Y.Y., Yi, S.M., Zhang, M.T., Chen, C.-C., Guo, R.-T. | Deposition date: | 2023-08-15 |
|
PDBID: | 9f7n | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-04 |
|
PDBID: | 9epn | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-19 |
|
PDBID: | 9ex7 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the E. coli BrxX methyltransferase in complex with Ocr | Authors: | Adams, M.C., Ghilarov, D. | Deposition date: | 2024-04-05 |
|
PDBID: | 8xtq | Status: | HPUB -- hold until publication | Title: | CryoEM Structure of intron 2 | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Dong, H.H., Huang, D.M., Su, Z.M. | Deposition date: | 2024-01-11 |
|
PDBID: | 8kfi | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-15 |
|
PDBID: | 9eru | Status: | AUTH -- processed, waiting for author review and approval | Title: | Mouse CNPase catalytic domain with nanobody 7E | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | Deposition date: | 2024-03-25 | Release date: | 2025-03-25 |
|
PDBID: | 8xtr | Status: | HPUB -- hold until publication | Title: | CryoEM Structure of the intron 3 | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | Deposition date: | 2024-01-11 |
|
PDBID: | 9ewc | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-03 |
|
PDBID: | 8xtp | Status: | HPUB -- hold until publication | Title: | CryoEM Structure of intron 4 | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Yang, Y., Dong, H.H., Huang, D.M., Su, Z.M. | Deposition date: | 2024-01-11 |
|
PDBID: | 9ewh | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant Y109A | Authors: | Dhamotharan, K., Schlundt, A., Guenther, S. | Deposition date: | 2024-04-03 |
|
PDBID: | 8q7d | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-16 |
|
PDBID: | 8xts | Status: | HPUB -- hold until publication | Title: | CryoEM Structure of intron 1 | Authors: | Wang, L., Xie, J.H., Zhang, C., Zou, J., Huang, Z.R., Chen, X.Y., Dong, H.H., Huang, D.M., Su, Z.M. | Deposition date: | 2024-01-11 |
|