| PDBID: | 8xsa | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Indigo | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 9eq6 | | Status: | HPUB -- hold until publication | | Title: | Cachd1 and FZD5 complex | | Authors: | Zhao, Y., Ren, J., Jones, E.Y. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8q6l | | Status: | HPUB -- hold until publication | | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9f1m | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 45 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8xso | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8keu | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-13 | | Release date: | 2024-08-13 |
|
| PDBID: | 9eqs | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 100uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8x8u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of F.occidentalis GABARAP | | Authors: | Zhang, S.Q., Luo, X., Wu, Z.L., Zhao, K.H., Li, X.Y. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8ker | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 XBB Variant Spike protein complexed with broadly neutralizing antibody PW5-535 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9eqq | | Status: | HPUB -- hold until publication | | Title: | Uhgb_MS mannoside synthase from an unknown human gut bacterium in complex with Mannose | | Authors: | Cioci, G., Ladeveze, S., Potocki-Veronese, G. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8xsr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8kep | | Status: | HPUB -- hold until publication | | Title: | The local refined map of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9ez5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BsmI (Inactive) crystallized with Mg2+ and cognate dsDNA | | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8xst | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8keo | | Status: | HPUB -- hold until publication | | Title: | Structure of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f24 | | Status: | HPUB -- hold until publication | | Title: | DARPin eGFP complex DP4 (2G71) | | Authors: | Mittl, P.R., Winkelvoss, D. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8xss | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8keq | | Status: | HPUB -- hold until publication | | Title: | State 1 of SARS-CoV-2 XBB Variant Spike protein trimer complexed with antibody PW5-5 | | Authors: | Sun, L., Mao, Q., Wang, Y. | | Deposition date: | 2023-08-13 |
|
| PDBID: | 9f2c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8xsh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9erk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8kes | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-13 |
|
| PDBID: | 8xsg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9erz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8kev | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-13 |
|
