| PDBID: | 8yv3 | | Status: | HPUB -- hold until publication | | Title: | The heterotrimer structure of peptides derived from human collagen type I | | Authors: | Zhu, Y., Yang, X., Sun, F. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8yup | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8pxo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-23 | | Release date: | 2025-01-23 |
|
| PDBID: | 9ffm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 9ffn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8py2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound JMS-175-2 | | Authors: | Chandler, F., Zeqiraj, E. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 9ffo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8py0 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Oscillibacter ruminantium chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 9ffp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yvl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8pxq | | Status: | HPUB -- hold until publication | | Title: | SFX Ferric structure of Y389F variant of A type dye-decolourising peroxidase DtpAa | | Authors: | Lucic, M., Worrall, J.A.R., Hough, M.A., Pfalzgraf, H. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 9ffq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yvc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell:icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 19) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ffr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yvi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8py1 | | Status: | HPUB -- hold until publication | | Title: | Sensor domain of Asticcacaulis benevestitus chemoreceptor in complex with formate. | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Velando, F., Matilla, M.A., Martinez-Rodriguez, S. | | Deposition date: | 2023-07-24 | | Release date: | 2025-01-24 |
|
| PDBID: | 9ffs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yve | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9fft | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yvf | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 | | Sequence: | >Entity 1
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2
MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3
RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
| PDBID: | 9fg3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
| PDBID: | 8yvm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8py4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-25 | | Release date: | 2025-01-25 |
|
