| PDBID: | 8y5t | | Status: | HPUB -- hold until publication | | Title: | E.coli Transcription translation coupling complex in TTC-B state 5 (subclass 3) containing mRNA with 27-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and fusidic acid | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9f77 | | Status: | HPUB -- hold until publication | | Title: | BAZ2A bromodomain in complex with acetylpyrrole derivative compound 27-TND19 | | Authors: | Dalle Vedove, A., Cazzanelli, G., Caflisch, A., Lolli, G. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8kfj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-15 |
|
| PDBID: | 9f78 | | Status: | HPUB -- hold until publication | | Title: | BAZ2A bromodomain in complex with acetylpyrrole derivative compound 28-TN23 | | Authors: | Dalle Vedove, A., Cazzanelli, G., Caflisch, A., Lolli, G. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8y51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8q7d | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 9f7g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8y59 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM21 PRYSPRY (D355A) in complex with (S)-hydroxyl-acepromazine. | | Authors: | Lu, P., Cheng, Y., Xue, L., Ren, X., Huang, N., Han, T. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8q7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 | | Release date: | 2025-02-16 |
|
| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 8y4y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ferric iron-binding protein (FecB) from Vibrio alginolyticus in complex with ferric citrate | | Authors: | Jiang, J.Y., Lu, P., Nagata, K. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8q7k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-16 |
|
| PDBID: | 9f7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 8y50 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of L-2-keto-3-deoxyfuconate 4-dehydrogenase bound to NAD(H) in condition with L-KDGal | | Authors: | Akagashi, M., Watanabe, S. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8q7g | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol pH 7.0 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-08-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9f7p | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y5b | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM21 PRYSPRY (D355A) in complex with (R)-hydroxyl-acepromazine. | | Authors: | Lu, P., Cheng, Y., Xue, L., Ren, X., Huang, N., Han, T. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8q7o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the FZD3 cysteine-rich domain in complex with a nanobody (14478) | | Authors: | Hillier, J.S., Zhao, Y., Malinauskas, T., Jones, E.Y. | | Deposition date: | 2023-08-16 |
|
| PDBID: | 9f7q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y57 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9f7r | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8y5o | | Status: | HPUB -- hold until publication | | Title: | E.coli transcription translation coupling complex in TTC-B state 3 (subclass1) containing mRNA with 30-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9f7s | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-K229R mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 8kfq | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of EGFR(T797M/L858R) with small molecule inhibitor B6 | | Authors: | Wu, C., Ouyang, L. | | Deposition date: | 2023-08-16 |
|
| PDBID: | 8y55 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of NAMPT-PF403 | | Authors: | Yu, S.S., Liu, Y.B., Li, Y. | | Deposition date: | 2024-01-31 |
|
