PDBID: | 9bee | Status: | HPUB -- hold until publication | Title: | alphaB-crystallin N-terminal IXI variant in a fibril state | Authors: | McFarland, R., Reichow, S.L. | Deposition date: | 2024-04-15 |
|
PDBID: | 8vcz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwt | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bem | Status: | AUTH -- processed, waiting for author review and approval | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with seven Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 8vce | Status: | HPUB -- hold until publication | Title: | Crystal Structure of plant Carboxylesterase 20 | Authors: | Palayam, M., Shabek, N. | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9beb | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 8vd1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwv | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bea | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-15 |
|
PDBID: | 8vcv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody (GPC-C epitope) | Authors: | Brouwer, P.J.M., Perrett, H.R., Ward, A.B. | Deposition date: | 2023-12-14 |
|
PDBID: | 7gww | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9be7 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 8vd3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwx | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9be8 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 8vd7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 7gwy | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9be9 | Status: | HPUB -- hold until publication | Title: | HIV-1 Env 16055 dGly4 NFL | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 8vdj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 7gwz | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bec | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8vdh | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 7gx0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-09 |
|
PDBID: | 9bed | Status: | AUTH -- processed, waiting for author review and approval | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight molybdates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|