| PDBID: | 8vc7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 7gwb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdl | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8vc9 | | Status: | HPUB -- hold until publication | | Title: | Hybrid response regulator LvrB from Leptospira / phosphorylated REC form | | Authors: | Mechaly, A., Buschiazzo, A. | | Deposition date: | 2023-12-13 | | Sequence: | >Entity 1
MNKWKFLFLEDSLVDLELIQRQLNRAKIDYYPIHVSDSEGFSQAILDQKPHLILSDFSLPKYDGFSALKLAKKICPTTPFIFVSGTYGEEAAIQTLTMGATDYVLKDRIEKLLPAVQRALHELEDHELRIKAEKERYELEEQLRQSQKLEAMGVMAGTMAHEINNPLIAISEYAAMIAKGEVDSEKAKQLASKIRDESARISTIMKNLLRFSRDDKGSLYPVEVGEILVKLESITQQIFKMNRIDASWKNVEPGHSIQCREGQILQILLNLVNNAVDSLNQKYPEYDTEKRIILENSIVEENHKKYAEFSIQDFGTGIPIDIQKSIFKTFFTTKSADKGTGLGLSVSLGIAKEHGGSLNFESEPGRYTRFYLRVPIFDPSVQ
|
|
| PDBID: | 7gwc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdn | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8vca | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 7gwd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8vcb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 7gwe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdp | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8urz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-27 |
|
| PDBID: | 7gwf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 8us5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 7gwg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | | Deposition date: | 2024-04-12 | | Release date: | 2025-04-12 |
|
| PDBID: | 8ust | | Status: | REFI -- re-refined entry | | Deposition date: | 2023-10-29 |
|
| PDBID: | 7gwh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of anti-abTCR NANOBODY VHH | | Authors: | Qiu, Y. | | Deposition date: | 2024-04-12 |
|
| PDBID: | 8vcm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with galactose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 7gwi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bds | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-12 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 8vcp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dimeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
