| PDBID: | 7gvc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bcf | | Status: | HPUB -- hold until publication | | Title: | Chimeric protein of crocodile allergen Cro p 1.0101 and GFP | | Authors: | O''Malley, A., Ruethers, T., Lopata, A.L., Chruszcz, M. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8va3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 7gvd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bch | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | | Authors: | Mahoney, B.J., Clubb, R.T. | | Deposition date: | 2024-04-09 | | Sequence: | >Entity 1
SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
| PDBID: | 7gve | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bcg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Myeloid cell leukemia-1 (Mcl-1) complexed with compound | | Authors: | Zhao, B., Fesik, S.W. | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8vb0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 7gvf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bcl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8vaj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 7gvh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bck | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8va7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 7gvi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bcm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8va9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 7gvj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bcr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-09 | | Release date: | 2025-04-09 |
|
| PDBID: | 8vab | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-11 |
|
| PDBID: | 7gvk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bcn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8vah | | Status: | HPUB -- hold until publication | | Title: | E.coli PNPase in complex with single 8-oxoG RNA | | Authors: | Kim, W., Zhang, Y.J. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 9bcu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 7gvl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
