| PDBID: | 9b95 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the closed NF449-bound human P2X1 receptor | | Authors: | Felix, M.B., Alisa, G., Hariprasad, V., Jesse, I.M., David, M.T. | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
| PDBID: | 9b8v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v4w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Campylobacter concisus Csep1 | | Authors: | Anna, R., Xiaotian, Z. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b99 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 8v4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4e | | Status: | HPUB -- hold until publication | | Title: | Protein complex | | Authors: | Awad, W., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9g | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4d | | Status: | HPUB -- hold until publication | | Title: | Protein complex | | Authors: | Awad, W., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9l | | Status: | HPUB -- hold until publication | | Title: | RPRD1B C-terminal interacting domain bound to a pThr4 CTD peptide | | Authors: | Moreno, R.Y., Zhang, Y.J. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40333 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-02 |
|
| PDBID: | 8v4v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9b9v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v4z | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP7 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9bad | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9ba1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
