| PDBID: | 8uzg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-15 |
|
| PDBID: | 9avf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8u1h | | Status: | HPUB -- hold until publication | | Title: | Axle-less Bacillus sp. PS3 F1 ATPase mutant | | Authors: | Furlong, E.J., Zeng, Y.C., Brown, S.H.J., Sobti, M., Stewart, A.G. | | Deposition date: | 2023-09-01 |
|
| PDBID: | 9av9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8uxz | | Status: | HPUB -- hold until publication | | Title: | Structure of E. coli acetyl-CoA carboxylase (local reconstruction of the wide helical tube at 3.31 Angstrom resolution) | | Authors: | Xu, X., Silva de Sousa, A., Boram, T.J., Jiang, W., Lohman, R.J. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 9av4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8uxy | | Status: | HPUB -- hold until publication | | Title: | Consensus olfactory receptor consOR1 bound to L-menthol and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 9aux | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8uy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9av3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8uya | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9av0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8uy8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9auv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8uyq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Consensus olfactory receptor consOR4 bound to 2-methylthiazoline and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9auy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8uy6 | | Status: | HPUB -- hold until publication | | Title: | Aquaporin Z with ALFA tag and bound to nanobody | | Authors: | Stover, L., Bahramimoghaddam, H., Wang, L., Zhou, M., Laganowsky, A. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 9av1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli GuaB dCBS with inhibitor GNE9123 | | Authors: | Harris, S.F., Wu, P. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8uy5 | | Status: | HPUB -- hold until publication | | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 7naw | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2021-01-25 |
|
| PDBID: | 9avj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-03 |
|
| PDBID: | 8uz9 | | Status: | HPUB -- hold until publication | | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
| PDBID: | 9b25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the ER-alpha Ligand-binding Domain (L372S, L536S) in complex with NA98 | | Authors: | Nwachukwu, J.C., Min, C.K., Papa, A., Rangarajan, E.S., Izard, T., Sharma, A., Nettles, K.W. | | Deposition date: | 2024-03-14 |
|
| PDBID: | 8v36 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 9b2b | | Status: | HPUB -- hold until publication | | Title: | Estrogen Receptor Alpha Ligand Binding Domain in Complex with a Complete Estrogen Receptor Antagonists that Favors Tetramer Formation | | Authors: | Fink, E.C., Chawla, R., Wells, K.S., Barratt, S., Myles, D.C., Pena, G., Robello, B.W., Ng, R., Fanning, S.W. | | Deposition date: | 2024-03-14 |
|
