| PDBID: | 9j75 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-18 |
|
| PDBID: | 9bx2 | | Status: | HPUB -- hold until publication | | Title: | Class 2 model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 7g2j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8vhx | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of neck of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-02 | | Release date: | 2025-01-02 |
|
| PDBID: | 9j72 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-18 |
|
| PDBID: | 9bx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8vhz | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of a soybean CesA1 homotrimer | | Authors: | Ho, R., Palliniti, P., Zimmer, J. | | Deposition date: | 2024-01-02 |
|
| PDBID: | 9j73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-18 |
|
| PDBID: | 9bx3 | | Status: | HPUB -- hold until publication | | Title: | Class 5 model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8vi0 | | Status: | HPUB -- hold until publication | | Title: | Cryo EM structure of a soybean CesA6 homotrimer | | Authors: | Ho, R., Palliniti, P., Zimmer, J. | | Deposition date: | 2024-01-02 |
|
| PDBID: | 9j7g | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Keap1_compound_8 | | Authors: | Xu, K., Xu, K. | | Deposition date: | 2024-08-18 |
|
| PDBID: | 9bx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8vi7 | | Status: | HPUB -- hold until publication | | Title: | Bos Taurus Mitochondrial BC1 in complex with Atovaquone | | Authors: | Xia, D., Zhou, F., Esser, L. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9j7f | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Keap1_compound_1 | | Authors: | Xu, K., Xu, K. | | Deposition date: | 2024-08-18 |
|
| PDBID: | 9bx6 | | Status: | HPUB -- hold until publication | | Title: | Class 9 model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8vi9 | | Status: | HPUB -- hold until publication | | Title: | NEMO IKK-binding domain with bound small molecule fragment | | Authors: | Kennedy, A.E. | | Deposition date: | 2024-01-03 | | Sequence: | >Entity 1
GSWSVKELEDKNEELLSEIAHLKNEVARLKKLLQRCLAANQELRDAMRQSNQILRERAEELLHFQASQREEKEFLMSKFQEARKLVERLGLEKLELEDKNEELLSEIAHLKNEVARLKKLVGER
|
|
| PDBID: | 9j74 | | Status: | AUCO -- author corrections pending review | | Title: | Cryo-EM structure of URAT1 in complex with lesinurad | | Authors: | Zhao, Y., Yu, Z. | | Deposition date: | 2024-08-18 |
|
| PDBID: | 7g34 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bx8 | | Status: | HPUB -- hold until publication | | Title: | Class 12 model for preturnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8vi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9j7a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-18 |
|
| PDBID: | 7g3d | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 9bx7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-22 |
|
| PDBID: | 8via | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9j7i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-19 |
|
