| PDBID: | 8zr7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Skd3 | | Authors: | Lee, S., Lee, C. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 8tac | | Status: | HPUB -- hold until publication | | Title: | Designed DNA binding protein | | Authors: | Doyle, L., Stoddard, B.L., Glasscock, C.J., McHugh, R.P., Pecoraro, R.J. | | Deposition date: | 2023-06-27 |
|
| PDBID: | 3qhi | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp10 | | Authors: | Khan, S., Rodriguez, E., Patel, R., Gor, J., Mulloy, B., Perkins, S.J. | | Deposition date: | 2011-01-26 |
|
| PDBID: | 8zrn | | Status: | HPUB -- hold until publication | | Title: | Structure of abt | | Authors: | Su, J., Yu, Z., Zhao, Y. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 3qhj | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp12 | | Authors: | Khan, S., Rodriguez, E., Patel, R., Gor, J., Mulloy, B., Perkins, S.J. | | Deposition date: | 2011-01-26 |
|
| PDBID: | 8zr6 | | Status: | HPUB -- hold until publication | | Title: | Arabidopsis Carboxyl esterase CXE15 E271Q mutant | | Authors: | Arold, S.T., Hameed, U.F.S. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 8tav | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-28 |
|
| PDBID: | 8zrc | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-06-04 |
|
| PDBID: | 3qhk | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp14 | | Authors: | Khan, S., Rodriguez, E., Patel, R., Gor, J., Mulloy, B., Perkins, S.J. | | Deposition date: | 2011-01-26 |
|
| PDBID: | 3qhl | | Status: | POLC -- waiting for a policy decision | | Title: | Solution Structure of Heparan Sulphate dp16 | | Authors: | Khan, S., Rodriguez, E., Patel, R., Gor, J., Mulloy, B., Perkins, S.J. | | Deposition date: | 2011-01-26 |
|
| PDBID: | 8tck | | Status: | HPUB -- hold until publication | | Title: | Apo crystal Structure of modified HIV reverse transcriptase p51 domain (FPC1) | | Authors: | Pedersen, L.C., London, R.E. | | Deposition date: | 2023-07-02 |
|
| PDBID: | 8zrf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-04 |
|
| PDBID: | 8tcl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-02 |
|
| PDBID: | 8zj8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zri | | Status: | HOLD -- hold until a certain date | | Title: | EcGK filament at APO state. (CASP target) | | Authors: | Zhang, T., Leng, Q., Liu, L.J. | | Deposition date: | 2024-06-04 | | Release date: | 2024-07-30 | | Sequence: | >Entity 1
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVHRDDMITR
|
|
| PDBID: | 8zrg | | Status: | HPUB -- hold until publication | | Title: | Arabidopsis Carboxylesterase CXE15 C14S mutant | | Authors: | Arold, S.T., Hameed, U.F.S. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 8te8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI) | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-05 |
|
| PDBID: | 8zrh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HBcAg-D4 Fab complex | | Authors: | Zhang, Z., Ju, B., Liu, C., Yan, H. | | Deposition date: | 2024-06-04 |
|
| PDBID: | 8tf1 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8zrl | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-04 | | Release date: | 2025-06-04 |
|
| PDBID: | 8tf6 | | Status: | HPUB -- hold until publication | | Title: | X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution | | Authors: | Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ? | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8zrm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-04 |
|
| PDBID: | 8tnu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of TRNM-b*01 Fab in complex with HIV-1 Env trimer BG505.DS SOSIP | | Authors: | Roark, R.S., Morano, N.C., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2023-08-02 |
|
| PDBID: | 8zs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-05 |
|
| PDBID: | 8tqu | | Status: | HPUB -- hold until publication | | Title: | MPI51 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-08 |
|
