PDBID: | 8s3l | Status: | HPUB -- hold until publication | Title: | X-ray crystal structure of LsAA9A | Authors: | Frandsen, K.E.H., Di Domenico, V., Lo Leggio, L. | Deposition date: | 2024-02-20 |
|
PDBID: | 8zno | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Arachis hypogaea bc1 complex | Authors: | Ye, Y., Dong, J.Q., Yang, G.F. | Deposition date: | 2024-05-27 |
|
PDBID: | 8s3u | Status: | HPUB -- hold until publication | Title: | LysTt72, a lytic endopeptidase from Thermus thermophilus MAT72 phage vB_Tt72 | Authors: | Rypniewski, W., Biniek-Antosiak, K., Bejger, M. | Deposition date: | 2024-02-20 |
|
PDBID: | 8znk | Status: | HPUB -- hold until publication | Title: | chromone glycosyltransferase (UGT93BB1,SdUGT2) | Authors: | Zou, J.L., Li, H.Y., Wang, Z.L., Ye, M. | Deposition date: | 2024-05-27 |
|
PDBID: | 8s3w | Status: | HPUB -- hold until publication | Title: | LysTt72, a lytic endopeptidase from Thermus thermophilus MAT72 phage vB_Tt72 | Authors: | Rypniewski, W., Biniek-Antosiak, K., Bejger, M. | Deposition date: | 2024-02-20 |
|
PDBID: | 8znl | Status: | HPUB -- hold until publication | Title: | PD-L1 de novo designed binder with picomolar binding affinity | Authors: | Zhao, L. | Deposition date: | 2024-05-27 |
|
PDBID: | 8znm | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-27 |
|
PDBID: | 8s42 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-02-21 |
|
PDBID: | 8znn | Status: | AUTH -- processed, waiting for author review and approval | Title: | X-ray structure of human PPAR delta ligand binding domain in complex with a synthetic agonist 16a | Authors: | Dai, L., Sun, H., Feng, Z. | Deposition date: | 2024-05-27 |
|
PDBID: | 7g5a | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8s4d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8znj | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-27 |
|
PDBID: | 7g5d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8s4l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8znq | Status: | HOLD -- hold until a certain date | Title: | Solution structure of the complex of naphthyridine-azaquinolone and an RNA with ACG/AUA motif | Authors: | Fujiwara, A., Chen, Q., Nakatani, K., Murata, A., Kawai, G. | Deposition date: | 2024-05-27 | Release date: | 2025-05-27 |
|
PDBID: | 7g5e | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8s4f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 | Sequence: | >Entity 1 MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8znp | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-27 |
|
PDBID: | 8zni | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-05-27 |
|
PDBID: | 7g6f | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8s4j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8z3f | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 7g6x | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8s4i | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8zo9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-28 |
|