PDBID: | 8zk4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8rzx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 7g5t | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zjw | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8s0e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 7g5u | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zjh | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of YF24228-bound porcine bc1 complex | Authors: | Yang, G.-F., Wang, Y.-X., Dong, J.Q. | Deposition date: | 2024-05-15 |
|
PDBID: | 8s0d | Status: | HPUB -- hold until publication | Title: | H. sapiens MCM bound to double stranded DNA and ORC1-6 | Authors: | Greiwe, J.F., Weissmann, F., Diffley, J.F.X., Costa, A. | Deposition date: | 2024-02-13 |
|
PDBID: | 7g5v | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zjt | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of free nucleosome | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | Deposition date: | 2024-05-15 |
|
PDBID: | 8s02 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 7g5w | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zju | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of free nucleosome asterisk | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | Deposition date: | 2024-05-15 |
|
PDBID: | 8s05 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | ArnAB complex an archaeal ortholog of the Sec23/24 core motif | Authors: | Korf, L., Steinchen, W., Watad, M., Bezold, F., Vogt, M.S., Selbach, L., Penner, A., Tourte, M., Hepp, S., Albers, S.V., Essen, L.-O. | Deposition date: | 2024-02-13 |
|
PDBID: | 7g6b | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zk6 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Decarboxylase KDC4427 from Enterobacter sp. CGMCC 5087 | Authors: | Dong, S., Liu, L., Zhang, H. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 8rzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 | Sequence: | >Entity 1 MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAF(CRO)NRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP
>Entity 2 MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ
|
|
PDBID: | 7g6c | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zk7 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L from Enterobacter sp. CGMCC 5087 | Authors: | Dong, S., Liu, L., Zhang, H. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 8s0z | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-14 |
|
PDBID: | 7g6d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zk8 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L in complex with indole-3-pyruvic acid | Authors: | Dong, S., Liu, L., Zhang, H. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 8s10 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-14 |
|
PDBID: | 7g6e | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-05 | Release date: | 2024-12-07 |
|
PDBID: | 8zk9 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L in complex with phenylpyruvic acid | Authors: | Dong, S., Liu, L., Zhang, H. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|