| PDBID: | 8tgu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BG505 SOSIP trimer purified via Galanthus nivalis lectin chromatography | | Authors: | Parsons, R.J., Pothula, K., Acharya, P. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8z56 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITLNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8tgw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 1059 SOSIP trimer purified via Galanthus nivalis lectin chromatography | | Authors: | Pothula, K., Parsons, R.J., Acharya, P. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8z57 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment and ADP ribose | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITLNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8z58 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human N141V-SIRT5 in complex with succinylated Prx1 fragment | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQVIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
| PDBID: | 8tgt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8z5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tgx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8z5x | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z64 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 D614G S with three ACE2 receptors binding (RB3) in prefusion conformation (focused refinement of NTD-SD1-RBD-ACE2) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tgs | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with product UDP-Glucose and by-product analog VO4 (orthovanadate) | | Authors: | Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R. | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-13 |
|
| PDBID: | 8z6b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-18 | | Release date: | 2025-04-18 |
|
| PDBID: | 8tgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8z5w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z53 | | Status: | HPUB -- hold until publication | | Title: | Arabidopsis Dwarf14 (AtD14) co-crystallized in the presence of Zaxinone | | Authors: | Arold, S.T., Hameed, U.F.S. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8thf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-15 |
|
| PDBID: | 8z5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tho | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) | | Authors: | Viennet, T., Yin, M., Orkin, S.H., Arthanari, H. | | Deposition date: | 2023-07-17 | | Sequence: | >Entity 1
SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
|
|
| PDBID: | 8z5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8thq | | Status: | HPUB -- hold until publication | | Title: | Nonamer RNA bound to hAgo2-PAZ | | Authors: | Pallan, P.S., Harp, J.M., Egli, M. | | Deposition date: | 2023-07-17 |
|
| PDBID: | 8z60 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5a | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Nur77 LBD in complex with NLM1 | | Authors: | Hong, W.B., Lin, T.W., Chen, X.Q. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8thw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 | | Release date: | 2024-11-17 |
|
| PDBID: | 8z5i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8thz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-18 |
|
