| PDBID: | 8rpt | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8yvd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rpv | | Status: | HPUB -- hold until publication | | Title: | Ku70-Ku80 (Ku) interacting with DNA in close conformation | | Authors: | Morin, V., Varela, P.F., Charbonnier, J.B. | | Deposition date: | 2024-01-17 |
|
| PDBID: | 8yvi | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rpw | | Status: | HPUB -- hold until publication | | Title: | Ku70-Ku80 (Ku) in apo form | | Authors: | Morin, V., Varela, P.F., Charbonnier, J.B. | | Deposition date: | 2024-01-17 |
|
| PDBID: | 8yve | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rey | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8yvf | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | | Deposition date: | 2024-03-28 | | Sequence: | >Entity 1
GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2
MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3
RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
| PDBID: | 8rq7 | | Status: | HPUB -- hold until publication | | Title: | Ku70-Ku80 (Ku) interacting with DNA | | Authors: | Morin, V., Varela, P.F., Charbonnier, J.B. | | Deposition date: | 2024-01-17 |
|
| PDBID: | 8yvm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rqd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-17 | | Release date: | 2025-01-17 |
|
| PDBID: | 8yvn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rqe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-18 |
|
| PDBID: | 8yvj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2592-2710 bound to H5.2 nanobody | | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rqi | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Rhizobium NopD with ubiquitin | | Authors: | Reverter, D., Li, Y. | | Deposition date: | 2024-01-18 | | Release date: | 2025-01-18 |
|
| PDBID: | 8yv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rqt | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Pichia pastoris Pex8 | | Authors: | Ekal, L., Burgi, J., Chojnowski, G., WIlmanns, M. | | Deposition date: | 2024-01-19 | | Release date: | 2025-01-19 |
|
| PDBID: | 8yv7 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Thialysine N-epsilon-acetyltransferase from Caenorhabditis elegans | | Authors: | Wang, N., Ma, X. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 3mmq | | Status: | POLC -- waiting for a policy decision | | Title: | Solution structure of human complement C3u | | Authors: | Li, K., Gor, J., Perkins, S.J. | | Deposition date: | 2010-04-20 |
|
| PDBID: | 8rqv | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase (T188A) AMP-PNP complex | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8yv5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rqs | | Status: | HPUB -- hold until publication | | Title: | Ternary complex between the heterodimer yKu70/yKu80, LigaseIV (BRCT1 + catalytic domain) and a Y-shaped DNA duplex | | Authors: | Morin, V., Varela, P.F., Charbonnier, J.B. | | Deposition date: | 2024-01-19 |
|
| PDBID: | 8yv8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8rqw | | Status: | HPUB -- hold until publication | | Title: | Erk2 MAP kinase (T188E) AMP-PNP complex | | Authors: | Livnah, O., Gutman, D. | | Deposition date: | 2024-01-20 |
|
| PDBID: | 8yva | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-28 | | Release date: | 2025-03-28 |
|
