| PDBID: | 8yta | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of PDE8A with 1604R | | Authors: | Huang, Y.-Y., Luo, H.-B. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8rnr | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with tetradecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8yth | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8rnp | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with R-limonene | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8yg3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8rni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8ygf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-26 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8yht | | Status: | HPUB -- hold until publication | | Title: | hTLR3/minibinder 7.7 | | Authors: | Kim, H., Kim, H. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8ro3 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of the staked Photosystem II - LHCII supercomplex from Chlorella ohadi | | Authors: | Fadeeva, M., Klaiman, D., Caspy, I., Nelson, N. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8yu1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-26 | | Release date: | 2025-03-26 |
|
| PDBID: | 8ro0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ytk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human prolyl-tRNA synthetase in complex with inhibitor | | Authors: | Luo, Z., Zhou, H. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ro1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the C. elegans Intron Lariat Spliceosome primed for disassembly (ILS'') | | Authors: | Vorlaender, M.K., Rothe, P., Plaschka, C. | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ytt | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ro6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ytj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of enterovirus A71 mature virion | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ro7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8ytm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of actinomycin D and Echinomycin-d(ACGATGCT/AGCACGT) complex | | Authors: | Wu, Y.S., Lee, Y.Y., Hou, M.H. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ro8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8yu0 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ro9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8yu2 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8roa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 8yim | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
