PDBID: | 9ioj | Status: | AUTH -- processed, waiting for author review and approval | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Complex, Apo form (Double Ring) | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | Deposition date: | 2024-07-09 |
|
PDBID: | 8rxd | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 9bci | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9gam | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-29 |
|
PDBID: | 8rxe | Status: | HPUB -- hold until publication | Title: | NMR Solution Structure of Cold Shock Protein CspA | Authors: | Wanko, M., Dambon, C., Feller, G., Volkov, O. | Deposition date: | 2024-02-07 |
|
PDBID: | 9bcf | Status: | HPUB -- hold until publication | Title: | Chimeric protein of crocodile allergen Cro p 1.0101 and GFP | Authors: | O''Malley, A., Ruethers, T., Lopata, A.L., Chruszcz, M. | Deposition date: | 2024-04-09 |
|
PDBID: | 9gak | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-29 |
|
PDBID: | 8rxi | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-07 |
|
PDBID: | 9bch | Status: | HPUB -- hold until publication | Title: | Solution structure of the hemoglobin receptor HbpA from Corynebacterium diphtheriae | Authors: | Mahoney, B.J., Clubb, R.T. | Deposition date: | 2024-04-09 | Sequence: | >Entity 1 SEEVKNADLYWGFSGSSHHKYDHNGPKFEKAGKGAELTNIDAASAYAETFKKGVFPNNKREKSDILVFHNGEVKTETNHSSYQINWPGEVTMKLGYGDGLVIKDLNLMLKNGNMGELKATVGENSNITLFDVQEYSVSDNTITVTPKIPPCTTGTWKPWHNDLTSKLGSLKSVFFESYTCNNDDIAKKPLPLTVVLNG
|
|
PDBID: | 9gau | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-29 |
|
PDBID: | 8rxj | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-07 |
|
PDBID: | 9bcl | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9gaj | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-29 |
|
PDBID: | 8rxk | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-07 |
|
PDBID: | 9bck | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9gai | Status: | HPUB -- hold until publication | Title: | 3-methylbenzoyl-CoA reductase from Thauera chlorobenzoica (MbdONPQ) | Authors: | Ermler, U., Boll, M., Demmer, U., Fuchs, J. | Deposition date: | 2024-07-29 |
|
PDBID: | 8rxl | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-07 | Sequence: | >Entity 1 PAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRDVEHHHHHH
|
|
PDBID: | 9bcn | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9gan | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-29 |
|
PDBID: | 8rxs | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-07 |
|
PDBID: | 9bco | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9gap | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-29 |
|
PDBID: | 8rxm | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Galectin-3 in complex with thiogalactoside derivative | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | Deposition date: | 2024-02-07 |
|
PDBID: | 9bcp | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9gaq | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-29 |
|