PDBID: | 8rgf | Status: | HPUB -- hold until publication | Title: | Arginase 2 in complex with inhibitor | Authors: | Petersen, J. | Deposition date: | 2023-12-13 |
|
PDBID: | 8ynx | Status: | HPUB -- hold until publication | Title: | Crystal structure of Cag3-CagT complex from Helicobacter pylori | Authors: | Mok, C.Y., Au, S.W.N. | Deposition date: | 2024-03-12 |
|
PDBID: | 9fxn | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human mitochondrial nuclease EXOG (hEXOG) | Authors: | Karasinska, J.M., Szymanski, M.R. | Deposition date: | 2024-07-02 |
|
PDBID: | 8rgv | Status: | HPUB -- hold until publication | Title: | Myo-inositol-1-phosphate synthase from Thermochaetoides thermophila in complex with NAD | Authors: | Traeger, T.K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | Deposition date: | 2023-12-14 |
|
PDBID: | 8ynu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the myb domain of S.pombe Tbf1 in the P222 space group | Authors: | Zhou, Y.Z., Wu, Z.F. | Deposition date: | 2024-03-12 |
|
PDBID: | 9fxo | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME WITH A/P/E-SITE TRNA AND MRNA : LM32CS1C1 M2 OE MUTANT | Authors: | Rajan, K.S., Yonath, A. | Deposition date: | 2024-07-02 |
|
PDBID: | 8r0s | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-31 |
|
PDBID: | 8ynz | Status: | HPUB -- hold until publication | Title: | The structure of EfpA_BRD-8000.3 complex | Authors: | Li, D.L., Sun, J.Q. | Deposition date: | 2024-03-12 |
|
PDBID: | 9fxy | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal Structure of Autotaxin (ENPP2) with Type IV Inhibitor | Authors: | Borza, R., Joosten, R.P., Perrakis, A. | Deposition date: | 2024-07-02 |
|
PDBID: | 8yo0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-12 |
|
PDBID: | 9fxw | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of Autotaxin (ENPP2) with Type VI Inhibitor, a Novel Class of Inhibitors with Three-Point Lock Binding Mode | Authors: | Borza, R., Joosten, R.P., Perrakis, A. | Deposition date: | 2024-07-02 |
|
PDBID: | 8rgx | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8yad | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-08 |
|
PDBID: | 9fxu | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Crystal Structure of Autotaxin (ENPP2) with Type VI Inhibitor, a Novel Class of Inhibitors with Three-Point Lock Binding Mode | Authors: | Borza, R., Joosten, R.P., Perrakis, A. | Deposition date: | 2024-07-02 |
|
PDBID: | 8rh4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8yoc | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 9fx9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of RV-A89 | Authors: | Wald, J., Goessweiner-Mohr, N., Blaas, D., Marlovits, T.C. | Deposition date: | 2024-07-02 |
|
PDBID: | 8rhd | Status: | HPUB -- hold until publication | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | Deposition date: | 2023-12-15 |
|
PDBID: | 8yoh | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 9fxt | Status: | PROC -- to be processed | Deposition date: | 2024-07-02 |
|
PDBID: | 8rhm | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 | Sequence: | >Entity 1 GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
PDBID: | 8yol | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 9fy6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Single particle cryo-EM reconstruction of Bacillus Methanolicus encapsulin nano compartment | Authors: | Marles-Wright, J., McIver, Z., Basle, A., Ross, J. | Deposition date: | 2024-07-02 |
|
PDBID: | 8yom | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-13 |
|
PDBID: | 9fxz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Galectin-8 N-terminal carbohydrate recognition domain in complex with 4-(bromophenyl)phthalazinone D-galactal ligand | Authors: | Van Klaveren, S., Hakansson, M., Diehl, C., Nilsson, N.J. | Deposition date: | 2024-07-02 |
|