| PDBID: | 8rcc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8ylp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-06 | | Release date: | 2025-03-06 |
|
| PDBID: | 9ild | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Complex structure of Cap3 and CD-NTase | | Authors: | Li, F.Q., Ma, W.F. | | Deposition date: | 2024-06-29 |
|
| PDBID: | 8rch | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of mTORC1 with a paediatric kidney cancer-associated 1455-EWED-1458 duplication in mTOR, overall refinement | | Authors: | Anandapadamanaban, M., Hay, I.M., Perisic, O., Williams, R.L. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 9ile | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SME-1 Carbapenemase in Complex with Relebactam | | Authors: | Dhankhar, K., Hazra, S. | | Deposition date: | 2024-06-29 |
|
| PDBID: | 8ylo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-06 |
|
| PDBID: | 8rci | | Status: | HPUB -- hold until publication | | Title: | Human p53 DNA-binding domain bound to DARPin C10 | | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8ylv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-07 |
|
| PDBID: | 9ilf | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of human malectin in complex with nigerose. | | Authors: | Si, Y.L. | | Deposition date: | 2024-06-29 |
|
| PDBID: | 8rc6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of hexameric BTB domain of Drosophila CG6765 protein | | Authors: | Bonchuk, A.N., Naschberger, A., Baradaran, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
AENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQFFATMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRGLCRT
|
|
| PDBID: | 8ylx | | Status: | HPUB -- hold until publication | | Title: | Single particle cryo-EM reconstruction of Oryza sativa recombinant human serum albumin | | Authors: | Dong, C.J., Yang, D.C., Duan, B.R. | | Deposition date: | 2024-03-07 |
|
| PDBID: | 9ilh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-29 |
|
| PDBID: | 8rce | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR alfa Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
HHHHHHSSGLVPRGSHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
| PDBID: | 8ylw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-07 |
|
| PDBID: | 9fwh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SARS-CoV-2 NSP10-ExoN in complex with VT00019 | | Authors: | Krojer, T., Kozielski, F., Sele, C., Nyblom, M., Fisher, S.Z., Knecht, W. | | Deposition date: | 2024-06-30 |
|
| PDBID: | 8rd7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-07 |
|
| PDBID: | 9fwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-30 |
|
| PDBID: | 8y6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8rd1 | | Status: | HPUB -- hold until publication | | Title: | HUWE1 WWE domain in complex with compound 4 | | Authors: | Muenzker, L., Zak, K.M., Boettcher, J. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8ym4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 9fwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-30 |
|
| PDBID: | 8rd0 | | Status: | HPUB -- hold until publication | | Title: | HUWE1 WWE domain in complex with compound 3 | | Authors: | Muenzker, L., Boettcher, J. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8ym5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 9fwi | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Ensemble model of ligand-free SARS-CoV-2 NSP10-NSP14 (ExoN) and in complex with partially bound VT00025 | | Authors: | Krojer, T., Kozielski, F., Sele, C., Nyblom, M., Fisher, S.Z., Knecht, W. | | Deposition date: | 2024-06-30 |
|
| PDBID: | 9fwl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ensemble model of ligand-free SARS-CoV-2 NSP10-NSP14 (ExoN) and in complex with partially bound VT00025 | | Authors: | Krojer, T., Kozielski, F., Sele, C., Nyblom, M., Fisher, S.Z., Knecht, W. | | Deposition date: | 2024-06-30 |
|
